KEGG   Escherichia coli KO11FL: EKO11_1033
Entry
EKO11_1033        CDS       T01718                                 

Definition
(GenBank) gluconate transporter
  KO
K03299  gluconate:H+ symporter, GntP family
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:eko02000]
    EKO11_1033
Transporters [BR:eko02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   EKO11_1033
SSDB
Motif
Pfam: GntP_permease CitMHS
Other DBs
NCBI-ProteinID: ADX49668
Position
complement(1089559..1090923)
AA seq 454 aa
MSTITLLCIALAGVIMLLLLVIKAKVQPFVALLLVSLLVALAAGIPAGEVGKVMIAGMGG
VLGSVTIIIGLGAMLGRMIEHSGGAESLANYFSRKLGDKRTIAALTLAAFFLGIPVFFDV
GFIILAPIIYGFAKVAKISPLKFGLPVAGIMLTVHVAVPPHPGPVAAAGLLHADIGWLTI
IGIAISIPVGIVGYFAAKIINTRQYAMSVEVLEQMQLAPASEEGATKLSDKINPPGVALV
TSLIVIPIAIIMAGTVSATLMPPSHPLLGTLQLIGSPMVALMIALVLAFWLLALRRGWSL
QHTSDIMGSALPTAAVVILVTGAGGVFGKVLVESGVGKALANMLQMIDLPLLPAAFIISL
ALRASQGSATVAILTTGGLLSEAVMGLNPIQCVLVTLAACFGGLGASHINDSGFWIVTKY
LGLSVADGLKTWTVLTTILGFTGFLITWCVWAVI
NT seq 1365 nt   +upstreamnt  +downstreamnt
atgtccacaattacattgttatgcattgcgttagctggcgtaatcatgctgttgctgctg
gtcatcaaggcaaaggtacaaccattcgttgctctgctcctcgtcagcctgttagtcgca
cttgcggcgggtataccggcgggcgaagtgggtaaagtgatgatcgccgggatgggcggt
gtgcttggttccgtcactattattattggtctgggcgctatgctggggcgtatgatcgaa
cactctggtggtgcagagtcactggctaattatttcagtcgcaagttaggtgacaaacga
actatcgctgcgctgactctggcagcgttcttcctcggtattcccgtcttctttgatgtc
ggctttattattcttgcgccaatcatttacggttttgccaaggttgccaaaatatcgcca
ctcaaatttggcctgcctgtcgctggaatcatgctaactgttcatgtggcggtaccgccg
catccaggccctgtcgccgcagcggggttactccacgcagacatcggctggctaaccatc
atcggtattgcgatttctattcccgtagggattgttggctactttgcagcgaaaataatc
aatacgcgccaatatgcgatgtcggtggaagtactggaacagatgcaactggctccggcc
agtgaggaaggcgcaacaaaattaagcgataaaataaatccaccgggcgtcgcgctggtc
acctcgctaattgttattcctatcgcgattatcatggcgggtacggtttccgcaacactg
atgccgccttcgcatcccctgcttggtacgctacagctgatcggctcaccaatggtagct
ctaatgattgcgctggtgctggcattctggttattggctttacgtcgcggctggagctta
caacacaccagcgacattatgggctcagcccttcccactgcggcggtagtgattttggtt
actggtgctggaggggtatttggcaaagtgctggtggaatcgggcgtcggcaaagccctt
gccaatatgctacaaatgattgacctgcctctgttaccagccgcatttattatttcactg
gctctgcgtgcatcgcaggggtcagcaaccgtagcaatcctgacaaccggcgggttactc
tcagaagcggtgatgggattgaatccgattcagtgcgtattggtgacgctggcagcctgc
tttggtgggcttggcgcgtcacatattaatgactcagggttctggattgtgaccaaatat
ctggggttgtctgtagcagacggtctgaaaacctggacagtgttaacgaccattctcggt
tttaccggattcttaattacctggtgcgtatgggcggtaatttga

DBGET integrated database retrieval system