KEGG   Escherichia coli KO11FL: EKO11_1034
Entry
EKO11_1034        CDS       T01718                                 

Definition
(GenBank) Hydroxypyruvate isomerase
  KO
K22131  2-dehydrotetronate isomerase [EC:5.3.1.35]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_1034
Enzymes [BR:eko01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.35  2-dehydrotetronate isomerase
     EKO11_1034
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-ProteinID: ADX49669
Structure
PDB: 
1K77

Position
complement(1091012..1091788)
AA seq 258 aa
MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYDYSTLQIQKQLEQNHLTLALFN
TAPGDINAGEWGLSALPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRA
VFIDNLRYAADRFALHGKRILVEALSPDVKPHYLFSSQYQALAIVEEVARDNVFIQLDTF
HAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLFRLFDEVGYQGWIGCE
YKPRGLTEEGLGWFDAWR
NT seq 777 nt   +upstreamnt  +downstreamnt
atgcctcgttttgcagctaatttatccatgatgttcaccgaagtgccttttattgaacgc
ttcgccgcagcgcgaaaagccgggttcgatgctgtggaatttctgtttccctatgactac
tccaccctgcaaatccaaaagcaactggagcaaaaccatctgacactggcgctgttcaat
accgctcccggagatattaatgcgggggaatggggattatccgcccttcccggacgtgag
cacgaagcacacgcagacatcgacctggcactggaatatgcattggcgctcaattgtgaa
caagtccatgtgatggcaggcgtcgtgcccgctggcgaagacgctgaacggtaccgggca
gtatttatcgataatctccgctacgctgccgaccgctttgcgctacacggcaagcgaata
ttagttgaagcactcagccccgacgttaagcctcattatctcttctccagccagtatcag
gcactggctattgttgaagaggttgcgcgagataacgtgtttattcaactagatactttt
catgcgcaaaaagtagatggcaacctgacgcatttaatccgcgactacgctgggaaatat
gcgcacgtacaaattgccggactacctgatcgacatgaaccggacgatggagaaatcaac
tatccgtggctgttccgcctgttcgatgaggtgggatatcagggctggatcggttgtgaa
tataaacctcgtggcctcaccgaagaagggcttggctggtttgacgcctggcgctaa

DBGET integrated database retrieval system