KEGG   Escherichia coli KO11FL: EKO11_1035
Entry
EKO11_1035        CDS       T01718                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K22130  3-dehydro-4-phosphotetronate decarboxylase [EC:4.1.1.104]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_1035
Enzymes [BR:eko01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.104  3-dehydro-4-phosphotetronate decarboxylase
     EKO11_1035
SSDB
Motif
Pfam: Aldolase_II
Other DBs
NCBI-ProteinID: ADX49670
Position
complement(1091793..1092431)
AA seq 212 aa
MSDFAKVEQSLREEMTRIASSFFQRGYATGSAGNLSLLLPDGNLLATPTGSCLGNLDPQR
LSKVAADGEWLSGDKPSKEVLFHLALYRNNPRCKAVVHLHSTWSTALSCLQGLDSSNVIR
PFTPYVVMRMGNVPLVPYYRPGDKRIAQDLAELAADNQAFLLANHGPVVCGESLQEAANN
MEELEETAKLIFILGDRPIRYLTAGEIAELRS
NT seq 639 nt   +upstreamnt  +downstreamnt
atgagcgatttcgcaaaagtagagcagtctttgcgagaggagatgacgcggattgccagt
tcattctttcagcgcggctatgcaaccggttcggctggcaatctgtcgctgcttttacct
gacgggaatttactggcgacaccgacaggttcatgcctgggcaatctcgatccgcagcgg
ctttccaaagtcgccgcggatggcgaatggttaagtggtgacaaaccctcgaaagaggtg
ctctttcatctggcgctgtatcgcaacaatccgcgctgtaaagcggtggtgcatttgcac
agcacatggtcgacggcgctttcctgcctgcaagggctggacagcagcaacgttattcgt
ccgttcacaccatacgtggtgatgcggatgggaaatgtcccgctggtgccttattaccga
ccgggcgataaacgcatcgcacaggatctggcggaactggcagcagacaatcaggctttt
ttactggcaaatcatggcccagtggtttgcggtgaaagcctgcaagaagccgccaacaat
atggaagagctggaggaaacggcaaagctgatttttattctcggtgaccgcccgatccgt
tatctgaccgcaggtgaaattgcggaattaaggagttaa

DBGET integrated database retrieval system