KEGG   Escherichia coli KO11FL: EKO11_1036
Entry
EKO11_1036        CDS       T01718                                 

Definition
(GenBank) type III effector Hrp-dependent outer
  KO
K21948  3-dehydrotetronate 4-kinase [EC:2.7.1.217]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_1036
Enzymes [BR:eko01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.217  3-dehydrotetronate 4-kinase
     EKO11_1036
SSDB
Motif
Pfam: SBD_N NBD_C DUF1129 YAcAr EccE
Other DBs
NCBI-ProteinID: ADX49671
Position
complement(1092428..1093690)
AA seq 420 aa
MIKIGVIADDFTGATDIASFLVENGLPTVQINGVPTGKMPEAIDALVISLKTRSCPVVEA
TQQSLAALSWLQQQGCKQIYFKYCSTFDSTAKGNIGPVTDALMDALDTPFTVFSPALPVN
GRTVYQGYLFVMNQLLAESGMRHHPVNPMTDSYLPRLVEAQSTGRCGVVSAHVFEQGVDA
VRQELARLQQEGYRYAVLDALTEHHLEIQGEALRDAPLVTGGSGLAIGLARQWAQENGNQ
AREAGHPLAGRGVVLSGSCSQMTNRQVAHYRQIAPAREVDVARCLSTETLAAYAHELAEW
VLGQESVLAPLVFATASTDALAAIQQQYGAQKASQAVETLFSQLAARLAAEGVTRFIVAG
GETSGVVTQSLGIKGFHIGPTISPGVPWVNALDKPVSLALKSGNFGDEAFFSRAQREFLS
NT seq 1263 nt   +upstreamnt  +downstreamnt
atgatcaagattggcgttatcgccgatgattttaccggcgcgacggatatcgccagtttt
ctggtggaaaacggtctaccaacggtacaaattaacggtgttccaacaggtaaaatgccg
gaagcaatcgacgcactggtgatcagcctgaaaacgcgctcctgtccggtggttgaagcc
acacagcaatcgctggcggctctgagctggttgcaacagcaaggttgcaaacagatctat
ttcaaatactgctctactttcgacagtacggcgaaaggtaatatcggcccggttaccgat
gcattaatggatgctctcgacacgccgtttacggtcttctctccggccctgccggtcaac
ggacgtacggtttatcaggggtatttgttcgtaatgaatcaactgctggccgaatccggg
atgcgccatcacccggtaaatcccatgaccgacagctatcttccccgtctggttgaagcg
caatccacagggcgctgcggcgtcgtttcggcacatgttttcgaacaaggtgtggatgcc
gttcgtcaagagctggctcgcttacagcaagagggctaccgctacgcggtgcttgatgcg
ctgaccgaacaccatctggaaattcagggagaagccttgcgcgatgccccactggtaacg
ggcggttctggtctggcgattggcctggcccggcagtgggcgcaagaaaacggtaaccag
gctcgcgaagcagggcatccgctcgctgggcgcggcgtagtgctctccggttcatgctct
caaatgaccaaccgccaggtggcacattaccgtcaaattgcaccagcccgtgaagttgat
gtggcacgctgcctctcaaccgaaactctggccgcttatgcacacgaactggcagagtgg
gttctgggccaggaaagtgtacttgctccactggtttttgccaccgccagcactgacgca
ttggcagcaattcaacagcaatacggtgcacaaaaagccagtcaggcagtagaaactcta
ttttctcaactagcggcgcggttagcagcggaaggcgtgacacgctttattgtcgcaggc
ggtgagacctccggcgtagtcacacagagcctgggcataaaagggtttcatattggccca
accatttcccccggcgtgccgtgggtaaacgcactggataagcctgtctcactcgccctt
aaatctggcaacttcggtgatgaagcctttttttcacgagcccaaagagagtttttatca
tga

DBGET integrated database retrieval system