KEGG   Escherichia coli KO11FL: EKO11_1037
Entry
EKO11_1037        CDS       T01718                                 

Definition
(GenBank) 2-hydroxy-3-oxopropionate reductase
  KO
K08319  L-threonate 2-dehydrogenase [EC:1.1.1.411]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_1037
Enzymes [BR:eko01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.411  L-threonate 2-dehydrogenase
     EKO11_1037
SSDB
Motif
Pfam: NAD_binding_2 NAD_binding_11 3HCDH_N F420_oxidored Peptidase_M23 Methyltr_RsmB-F
Other DBs
NCBI-ProteinID: ADX49672
Position
complement(1093687..1094595)
AA seq 302 aa
MKTGSEFHVGIVGLGSMGMGAALSCVRAGLSTWGADLNSNACATLKEAGACGVSDNAATF
AEKLDALLVLVVNAAQVKQVLFGETGVAQHLKPGTAVMVSSTIASADAQEIATALAGFDL
EMLDAPVSGGAVKAANGEMTVMASGSDIAFERLAPVLEAVAGKVYRIGAEPGLGSTVKII
HQLLAGVHIAAGAEAMALAARAGIPLDVMYDVVTNAAGNSWMFENRMRHVVDGDYTPHSA
VDIFVKDLGLVADTAKALHFPLPLASTALNMFTSASNAGYGKEDDSAVIKIFSGITLPGA
KS
NT seq 909 nt   +upstreamnt  +downstreamnt
atgaaaacgggatctgagtttcatgtcggtatcgttggcttagggtcaatgggaatggga
gcagcactgtcatgtgtccgcgcaggtctttctacctggggcgcagacctgaacagcaat
gcctgcgctacgttgaaagaggcaggtgcttgcggggtttctgataacgccgcgacgttt
gccgaaaaactggacgctctgctggtgctggtggtcaatgcggcccaggttaaacaggtg
ctgtttggtgaaacaggcgttgcacaacatctgaaacccggtacggcagtaatggtttct
tccactatcgctagtgctgatgcgcaagaaattgctaccgctctggctggattcgatctg
gaaatgctggatgcgccagtttctggtggtgcagtaaaagccgctaacggtgaaatgact
gtcatggcctccggtagcgatattgcctttgaacgactggcacccgtgctggaagccgtt
gccggaaaagtttatcgcataggtgcagaaccgggactaggttcgaccgtaaaaattatt
caccagttgttagcgggcgtacatattgctgccggagccgaagcgatggcacttgcagcc
cgtgcggggatcccgctggatgtgatgtatgacgtcgtgaccaatgccgccggaaattcc
tggatgttcgaaaaccggatgcgtcatgtggtggatggcgattacaccccgcattcagcc
gtcgatatttttgttaaggatcttggtctggttgccgatacagccaaagccctgcacttc
ccgctgccattggcctcaacagcattgaatatgttcaccagcgccagtaacgcaggttac
gggaaagaagacgatagcgcagttatcaagattttctctggcatcactctaccgggagcg
aaatcatga

DBGET integrated database retrieval system