KEGG   Escherichia coli KO11FL: EKO11_1038
Entry
EKO11_1038        CDS       T01718                                 

Definition
(GenBank) transcriptional regulator, DeoR family
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: DeoRC HTH_DeoR HTH_11 GntR MarR HTH_24 MarR_2 Rrf2 Fe_dep_repress HTH_23 HTH_20 Put_DNA-bind_N E3_UFM1_ligase HTH_36 Ribosomal_S25 DDRGK HTH_38 HTH_5 FeoC HTH_28
Other DBs
NCBI-ProteinID: ADX49673
Position
1094791..1095558
AA seq 255 aa
MIPVERRQIILEMVAEKGIVSIAELTDRMNVSHMTIRRDLQKLEQQGAVVLVSGGVQSPG
RVAHEPSHQVKTALAMTQKAAIGKLAASLVQPGSCIYLDAGTTTLAIAQHLIHMESLTVV
TNDFVIANYLLDNSNCTIIHTGGAVCRENRSCVGEAAATMLRSLMIDQAFISASSWSVRG
ISTPAEDKVTVKRAIASASRQRVLVCDATKYGQVATWLALPLSEFDQIITDDGLPESASR
ALAKQDLSLLVAKNE
NT seq 768 nt   +upstreamnt  +downstreamnt
ttgatacccgtagagcgtcgccaaatcatccttgagatggtagctgaaaaaggcattgtc
agtattgctgaactaacggacagaatgaatgtgtcacatatgaccattcgtcgggattta
caaaaactggagcagcagggagccgttgtgctggtgtccggaggcgtccagtctccggga
cgcgtggcgcatgaaccttctcatcaggtaaaaactgcgctggcaatgacgcaaaaagcg
gctattggcaagctggcggcaagtcttgttcagccgggaagttgtatctatctggatgcg
ggaacgaccacgttagcgatagcacagcatctgattcacatggagtcactgactgtggtc
acaaacgatttcgttattgcgaactacttgctcgacaacagtaattgcacaattattcac
actggcggtgcagtgtgtcgggaaaaccgttcctgtgtcggggaagccgctgcgaccatg
ctgcgcagcctgatgattgatcaggcttttatttctgcatcgtcatggagtgtgcggggg
atttctacgccagcggaagataaagtcacggtgaaacgggcgattgccagtgccagccgc
cagcgagttttggtctgtgatgcgacgaaatatggtcaggtggcgacatggctggcgtta
ccattaagcgagtttgatcagattattacagacgacggtttgccggagagtgccagtcgc
gcgctggcgaagcaggatctctctttgctggtagcgaaaaatgaataa

DBGET integrated database retrieval system