KEGG   Escherichia coli KO11FL: EKO11_1039
Entry
EKO11_1039        CDS       T01718                                 

Definition
(GenBank) metallophosphoesterase
  KO
K07314  serine/threonine protein phosphatase 2 [EC:3.1.3.16]
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    EKO11_1039
Enzymes [BR:eko01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     EKO11_1039
SSDB
Motif
Pfam: Metallophos Metallophos_2
Other DBs
NCBI-ProteinID: ADX49674
Position
complement(1095609..1096265)
AA seq 218 aa
MPSTRYQKINAHHYRHIWVVGDIHGEYQLLQSRLHQLSFFPETDLLISVGDNIDRGPESL
DVLRLLNQPWFISVKGNHEAMALDAFATGDGNMWLASGGDWFFDLNDSEQKEATDLLLKF
HHLPHIIEITNDNIKYVIAHADYPGSEYLFGKEIAESELLWPVDRVQKSLNGELQQINGA
DYFIFGHMMFDNIQTFANQIYIDTGSPKSGRLSFYKIR
NT seq 657 nt   +upstreamnt  +downstreamnt
atgccatctacacgctatcaaaaaatcaatgcccatcactatcgccatatatgggtcgtt
ggtgatattcatggtgaatatcagttattacaatcccgcttacatcaactctcttttttc
cccgaaaccgacttacttatttctgtcggcgataatattgatcgtgggccggagagtctt
gacgtcctgcgcctgctaaaccagccctggtttatctccgttaaaggcaaccacgaagca
atggcgctggatgcgttcgcgaccggcgatggcaatatgtggcttgccagcggtggtgac
tggtttttcgatttaaatgattcagagcaaaaagaagctacagatctgttgctgaaattc
catcaccttccacatattattgaaatcactaacgacaacataaaatatgtcatcgcacat
gcagattatccggggagtgaatatctctttggtaaagaaatagcggagagcgaattactc
tggcctgttgatcgtgtgcagaaatcgcttaatggcgagttacaacaaataaacggcgct
gattattttatatttggacatatgatgtttgataacattcagacgttcgctaaccagatt
tatattgataccggatcgccgaaaagtgggcggctgtcattttataaaataaggtag

DBGET integrated database retrieval system