KEGG   Escherichia coli KO11FL: EKO11_1040
Entry
EKO11_1040        CDS       T01718                                 

Definition
(GenBank) DNA mismatch repair protein MutS
  KO
K03555  DNA mismatch repair protein MutS
Organism
eko  Escherichia coli KO11FL
Pathway
eko03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:eko00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03430 Mismatch repair
    EKO11_1040
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:eko03400]
    EKO11_1040
DNA repair and recombination proteins [BR:eko03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Mismatch and loop recognition factors
     EKO11_1040
SSDB
Motif
Pfam: MutS_V MutS_I MutS_III MutS_II MutS_IV
Other DBs
NCBI-ProteinID: ADX49675
Structure
PDB: 

Position
complement(1096371..1098932)
AA seq 853 aa
MSAIENFDAHTPMMQQYLKLKAQHPEILLFYRMGDFYELFYDDAKRASQLLDISLTKRGA
SAGEPIPMAGIPYHAVENYLAKLVNQGESVAICEQIGDPATSKGPVERKVVRIVTPGTIS
DEALLQERQDNLLAAIWQDSKGFGYATLDISSGRFRLSEPADRETMAAELQRTNPAELLY
AEDFAEMSLIEGRRGLRRRPLWEFEIDTARQQLNLQFGTRDLVGFGVENAPRGLCAAGCL
LQYAKDTQRTTLPHIRSITMEREQDSIIMDAATRRNLEITQNLAGGAENTLASVLDCTVT
PMGSRMLKRWLHMPVRDTRVLLERQQTIGALQDFTAELQPVLRQVGDLERILARLALRTA
RPRDLARMRHAFQQLPELRAQLETVDSAPVQALREKMGEFAELRDLLERAIIDTPPVLVR
DGGVIASGYNEELDEWRALADGATDYLERLEVRERERTGLDTLKVGFNAVHGYYIQISRG
QSHLAPINYMRRQTLKNAERYIIPELKEYEDKVLTSKGKALALEKQLYEELFDLLLPHLE
ALQQSASALAELDVLVNLAERAYTLNYTCPTFIDKPGIRITEGRHPVVEQVLNEPFIANP
LNLSPQRRMLIITGPNMGGKSTYMRQTALIALMAYIGSYVPAQKVEIGPIDRIFTRVGAA
DDLASGRSTFMVEMTETANILHNATEYSLVLMDEIGRGTSTYDGLSLAWACAENLANKIK
ALTLFATHYFELTQLPEKMEGVANVHLDALEHGDTIAFMHSVQDGAASKSYGLAVAALAG
VPKEVIKRARQKLRELESISPNAAATQVDGTQMSLLSVPEETSPAVEALENLDPDSLTPR
QALEWIYRLKSLV
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgagtgcaatagaaaatttcgacgcccatacgcccatgatgcagcagtatctcaagctg
aaagcccagcatcccgagatcctgctgttttaccggatgggtgatttttatgaactgttt
tatgacgacgcaaaacgcgcgtcgcaactgctggatatttcactgaccaaacgcggtgct
tcggcgggagagccgatcccgatggcagggatcccctaccatgcggtggaaaactacctc
gccaaactggtgaatcagggcgagtccgttgccatctgcgaacaaattggcgatccggcg
accagcaaaggtccggttgagcgcaaagttgtgcgtatcgttacgccaggcaccatcagc
gatgaagccctgttacaggagcgtcaggacaacctgctggcggctatctggcaggacagc
aaaggtttcggctacgcgacgctggatatcagctccgggcgttttcgcctgagcgaaccg
gctgaccgggaaacgatggcggcagaactgcaacgcactaatcctgcggaactgctgtat
gcagaagattttgctgaaatgtcgttaattgaaggccgtcgcggcctgcgccgtcgcccg
ctgtgggagtttgaaatcgacaccgcgcgccagcagttgaatctgcaatttggcactcgc
gatctggtcggttttggcgtcgagaacgcgccgcgcggactttgtgctgccggttgtctg
ttgcagtatgcgaaagatacccaacgtacgactctgccgcatattcgttccatcaccatg
gaacgtgagcaggacagcatcattatggatgccgcgacgcgtcgtaatctggaaatcacc
cagaacctggcgggtggtgcggaaaatacgctggcttctgtgctcgactgcaccgtcacg
ccgatgggcagccgtatgctgaaacgctggctgcatatgccagtgcgcgatacccgcgtg
ttgcttgagcgccagcaaactatcggcgcattgcaggatttcaccgccgagttgcagccg
gtactgcgtcaggtcggcgacctggaacgtattctggcacgtctggctttacgaactgct
cgcccacgcgatctggcccgtatgcgccacgctttccagcaactgccggagctgcgtgca
cagttagaaactgtcgatagtgcaccggtacaggcgctacgtgagaagatgggcgagttt
gccgagctgcgcgatctgctggagcgagcaatcatcgacacaccgccggtgctggtacgc
gacggtggtgttatcgcatcgggctataacgaagagctggatgagtggcgcgcgctggct
gacggcgcgaccgattatctggagcgtctggaagtccgcgagcgtgaacgtaccggcctg
gacacgctgaaagttggctttaatgcggtgcacggctactacattcaaatcagccgtggg
caaagccatctggcacccatcaactacatgcgtcgccagacgctgaaaaacgccgagcgc
tacatcattccagagctaaaagagtacgaagataaagttctcacctcaaaaggcaaagca
ctggcactggaaaaacagctttatgaagagctgttcgacctgctgttgccgcatctggaa
gcgttgcaacagagcgcgagcgcgctggcggaactcgacgtgctggttaacctggcggaa
cgggcctataccctgaactacacctgcccgaccttcattgataaaccgggcattcgcatt
accgaaggtcgccatccggtagttgaacaagtactgaatgagccatttatcgctaacccg
ctgaatctgtcgccgcagcgccgtatgttgattattaccggcccgaacatgggcggtaaa
agtacctatatgcgccagaccgcactgattgcgctgatggcctacatcggcagctatgta
ccggcacaaaaagtcgagattggacctatcgatcgcatctttacccgcgtaggcgcggca
gatgacctggcttccgggcgctcaacctttatggtggagatgactgaaaccgccaatatt
ttacataacgccaccgaatacagtctggtgttaatggatgagatcgggcgtggaacgtcc
acctacgatggtctgtcgctggcgtgggcgtgcgcagaaaatctggcgaataagattaag
gcattgacgctgtttgccacccactatttcgagctgacccagctaccggagaaaatggaa
ggcgtcgccaacgtacatctcgatgcgctggagcacggcgacactatcgcctttatgcac
agcgtgcaggacggcgcggcgagcaaaagctacggtctggcggttgctgctctggcgggc
gtaccgaaagaggttattaagcgcgcacggcaaaaactgcgtgagctggaaagcatttcg
ccgaacgccgccgctacgcaagtggatggtacgcaaatgtctttgctgtccgtaccagaa
gaaacttcgcctgcggtcgaggcactggaaaacctggacccggattcactgactccgcgt
caggcgctggagtggatttatcgcttgaagagtctggtgtaa

DBGET integrated database retrieval system