KEGG   Escherichia coli KO11FL: EKO11_1041
Entry
EKO11_1041        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Other DBs
NCBI-ProteinID: ADX49676
Position
1099008..1099187
AA seq 59 aa
MIPELIISGEEANGEFLMLVPGKMLFCSFCVMLMKQVRKIASVGEPFFFRVIVPFKIKM
NT seq 180 nt   +upstreamnt  +downstreamnt
atgataccggagttaatcatttcaggggaagaagcgaacggtgagttcttgatgctggtt
ccgggaaagatgctgttttgcagcttttgcgtgatgcttatgaagcaagtacgcaaaatt
gcgtcggttggcgaacctttcttctttagagtcatagtgccctttaagattaagatgtaa

DBGET integrated database retrieval system