KEGG   Escherichia coli KO11FL: EKO11_1042
Entry
EKO11_1042        CDS       T01718                                 

Definition
(GenBank) hypothetical protein
Organism
eko  Escherichia coli KO11FL
SSDB
Motif
Pfam: YgbA_NO DUF5645
Other DBs
NCBI-ProteinID: ADX49677
Position
1099219..1099572
AA seq 117 aa
MSGKRISREKLTIKKMIDLYQAKCPQASAEPEHYEALFVYAQKRLDKCVFGEEKPACKQC
PVHCYQPAKREEMKQIMRWAGPRMLWRHPILTVRHLIDDKRPVPELPEKYRPKKPRE
NT seq 354 nt   +upstreamnt  +downstreamnt
atgtccggcaagcgtatctctcgtgaaaaactgacgattaaaaaaatgatcgatctttat
caagcgaaatgcccgcaggcgtcagcggagccggagcattacgaggcgttgtttgtttac
gcgcaaaagcggctggataaatgtgtgttcggcgaagagaaaccagcctgtaagcagtgt
ccggtgcactgttaccagcctgcaaagcgtgaagagatgaaacagattatgcgttgggcc
gggccgagaatgctgtggcgtcatccgatcttaaccgtgcgtcatctcatcgatgacaag
cgtccggtgccagaactgccggaaaaatatcgtccgaaaaaacctcgtgaatag

DBGET integrated database retrieval system