KEGG   Escherichia coli KO11FL: EKO11_1043
Entry
EKO11_1043        CDS       T01718                                 

Definition
(GenBank) transcriptional regulator, NifA subfamily, Fis Family
  KO
K15836  formate hydrogenlyase transcriptional activator
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:eko03000]
    EKO11_1043
Transcription factors [BR:eko03000]
 Prokaryotic type
  Helix-turn-helix
   Other families
    EKO11_1043
SSDB
Motif
Pfam: Sigma54_activat Sigma54_activ_2 GAF GAF_2 GAF_3 AAA_5 AAA HTH_8 IstB_IS21 Mg_chelatase AAA_16 ABC_tran HTH_50 AAA_7 AAA_30
Other DBs
NCBI-ProteinID: ADX49678
Position
complement(1099609..1101687)
AA seq 692 aa
MSYTPMSDLGQQGLFDITRTLLQQPDLASLCEALSQLVKRSALADNAAIVLWQAQTQRAS
YYASREKDTPIKYEDETVLAHGPVRSILSRPDTLHCSYEEFCETWPQLAAGGLYPKFGHY
CLMPLAAEGHIFGGCEFIRYDDRPWSEKEFNRLQTFTQIVSVVTEQIQSRVVNNVDYELL
CRERDNFRILVAITNAVLSRLDMDELVSEVAKEIHYYFDIDDISIVLRSHRKNKLNIYST
HYLDKQHPAHEQSEVDEAGTLTERVFKSKEMLLINLHERDDLAPYERMLFDTWGNQIQTL
CLLPLMSGDTMLGVLKLAQCEEKVFTTTNLNLLRQIAERVAIAVDNALAYQEIHRLKERL
VDENLALTEQLNNVDSEFGEIIGRSEAMYSVLKQVEMVAQSDSTVLILGETGTGKELIAR
AIHNLSGRNNRRMVKMNCAAMPAGLLESDLFGHERGAFTGASAQRIGRFELADKSSLFLD
EVGDMPLELQPKLLRVLQEQEFERLGSNKIIQTDVRLIAATNRDLKKMVADREFRSDLYY
RLNVFPIHLPPLRERPEDIPLLAKAFTFKIARRLGRNIDSIPAETLRTLSNMEWPGNVRE
LENVIERAVLLTRGNVLQLSLPDIVLPEPETPPAATVVAQEGEDEYQLIVRVLKETNGVV
AGPKGAAQRLGLKRTTLLSRMKRLGIDKSALI
NT seq 2079 nt   +upstreamnt  +downstreamnt
atgtcatatacaccgatgagtgatctcggacagcaagggttgttcgacatcactcggaca
ctattgcagcagcccgatctggcctcgctgtgtgaggctctttcgcaactggtaaagcgt
tctgcgctcgccgacaacgcggctattgtgttgtggcaagcgcagactcaacgtgcgtct
tattacgcatcgcgtgaaaaagacacccccattaaatatgaagacgaaactgttctggca
cacggtccggtacgcagcattttgtcgcgccctgatacgctgcattgcagttacgaagaa
ttttgtgaaacctggccgcagctggccgcaggtgggctatacccaaaatttggtcactat
tgcctgatgccactggcggcagaagggcatatttttggtggctgtgaatttattcgttat
gacgatcgcccctggagcgaaaaagagttcaatcgtctgcaaacatttacgcagatcgtt
tctgtcgtcaccgaacaaatccagagccgcgtcgtcaacaatgtcgactatgagttgtta
tgccgggagcgcgataacttccgcatcctggttgccattaccaacgcggtgctttcccgc
ctggatatggacgaactggtcagcgaagtcgccaaagaaatccattactatttcgacatt
gacgatatcagtatcgtcttacgcagccaccgtaaaaacaaactcaacatctactccact
cactatcttgataaacaacatcccgcccacgaacagagcgaagtcgatgaagccggaacc
ctcaccgaacgcgtgttcaaaagtaaagagatgctgctgatcaatctccacgagcgggac
gatttagccccctatgaacgcatgttgttcgacacctggggcaaccagattcaaaccttg
tgcctgttaccgctgatgtctggcgacaccatgctgggcgtgctgaaactggcgcaatgc
gaagagaaagtgtttaccactaccaatctgaatttactgcgccagattgccgaacgtgtg
gcaatcgctgtcgataacgccctcgcctatcaggaaatccatcgtctgaaagaacggctg
gttgatgaaaacctcgccctgaccgagcagctcaacaatgttgatagtgaatttggcgag
attattggccgcagcgaagccatgtacagcgtgcttaaacaagttgaaatggtggcgcaa
agtgacagtaccgtgctgatcctcggtgaaactggcacgggtaaagagctgattgcccgt
gcgatccataatctcagtgggcgtaataatcgccgcatggtcaaaatgaactgcgcggcg
atgcctgccggattgctggaaagcgatctgtttggtcatgagcgtggggcttttaccggt
gccagcgcccagcgcattggtcgttttgaactggcggataaaagctccctgttcctcgac
gaagtgggcgatatgccactggagttacagccgaagttgctgcgtgtattgcaggaacag
gagtttgaacgtctcggcagcaacaaaatcattcagacggacgtgcgtctaatcgccgcg
actaaccgcgatctgaaaaaaatggtcgccgaccgtgagttccgtagcgatctctattac
cgcctgaacgtattcccgattcacctgccgccactacgcgagcgtccggaagatattccg
ctgctggcgaaagcctttaccttcaaaattgcccgtcgtctggggcgcaatatcgacagc
attcctgccgagacgctgcgcaccttgagcaacatggagtggccgggtaacgtacgcgaa
ctggaaaacgtcattgagcgcgcggtattgctaacacgcggtaacgtgctgcagctgtca
ttgccagatattgttttaccggaacctgaaacgccgcctgccgcaacggttgtcgcccag
gagggcgaagatgaatatcagttgattgttcgcgtgctgaaagaaaccaacggcgtggtt
gccgggcctaaaggcgctgcgcaacgtctggggctgaaacgcacgaccctgctgtcacgg
atgaagcggctgggaattgataaatcggcattgatttaa

DBGET integrated database retrieval system