KEGG   Escherichia coli KO11FL: EKO11_1045
Entry
EKO11_1045        CDS       T01718                                 

Definition
(GenBank) hydrogenase expression/formation protein HypD
  KO
K04654  hydrogenase expression/formation protein HypD
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    EKO11_1045
SSDB
Motif
Pfam: HypD
Other DBs
NCBI-ProteinID: ADX49680
Position
complement(1102768..1103889)
AA seq 373 aa
MRFVDEYRAPEQVMQLIEHLRERASHLSYTAERPLRIMEVCGGHTHAIFKFGLDQLLPEN
VEFIHGPGCPVCVLPMGRIDTCVEIASHPEVIFCTFGDAMRVPGKQGSLLQAKARGADVR
IVYSPMDALKLAQENPTRKVVFFGLGFETTMPTTAITLQQAKARDVQNFYFFCQHITLIP
TLRSLLEQPDNGIDAFLAPGHVSMVIGTDAYNFIASDFHRPLVVAGFEPLDLLQGVVMLV
EQKIAAHSKVENQYRRVVPDAGNLLAQQAIADVFCVNGDSEWRGLGVIESSGVHLTPDYQ
RFDAEAHFRPAPQQVCDDPRARCGEVLTGKCKPHQCPLFGNTCNPQTAFGALMVSSEGAC
AAWYQYRQQESEA
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgcgttttgttgatgaatatcgcgcgccggaacaggtgatgcagttaattgagcatctg
cgcgaacgtgcttcacatctctcttacaccgccgaacgccctctgcggattatggaagtg
tgtggcggtcatacccacgctatctttaaattcggcctcgaccagttactgccggaaaac
gttgagtttatccacggtccgggttgtccggtgtgtgtactgccgatgggtagaatcgac
acctgcgtggagattgccagccatccggaagtcatcttctgtacctttggcgacgccatg
cgcgtaccagggaaacagggatcgctgttgcaggcaaaagcacgcggtgccgatgtgcgc
atcgtttactcgccgatggatgcgttgaaactggcgcaggagaatccaacccgtaaagtc
gtattcttcggcttaggttttgaaaccaccatgccgaccaccgccatcaccctgcaacag
gcgaaagcccgcgatgtgcagaatttttacttcttctgccagcatattacgcttatcccg
acgctgcgcagtttgctggaacagccggataacggtatcgacgcgttcctcgcgccgggc
cacgttagtatggttatcggcactgatgcctataattttatcgccagcgattttcatcgt
ccgctggtggtcgctggtttcgaaccccttgatctactacaaggcgtggtcatgctggtg
gagcagaaaatagcggcccacagcaaggtagagaatcagtatcgtcgagtggtaccggat
gccggtaacctgctggcgcaacaggcgattgccgatgtgttctgtgtcaacggcgacagc
gaatggcgcggcttaggcgtgattgaatcttctggcgtacacctgacgccggattatcaa
cgattcgatgccgaagcacatttccgcccggcaccgcagcaggtctgcgatgacccgcgc
gcacgttgtggtgaagtattaacgggcaaatgtaagccgcatcaatgcccgctgtttggt
aacacctgtaatcctcaaaccgcatttggtgcactgatggtctcctccgaaggagcgtgc
gccgcgtggtatcagtatcgtcagcaggagagtgaagcgtga

DBGET integrated database retrieval system