KEGG   Escherichia coli KO11FL: EKO11_1046
Entry
EKO11_1046        CDS       T01718                                 

Definition
(GenBank) hydrogenase assembly chaperone hypC/hupF
  KO
K04653  hydrogenase expression/formation protein HypC
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99975 Protein processing
    EKO11_1046
SSDB
Motif
Pfam: HupF_HypC
Other DBs
NCBI-ProteinID: ADX49681
Structure
PDB: 
2OT2

Position
complement(1103889..1104161)
AA seq 90 aa
MCIGVPGQIRTIDGNQAKVDVCGIQRDVDLTLVGSCDENGQPRVGQWVLVHVGFAMSVIN
EAEARDTLDALQNMFDVEPDVGALLYGEEK
NT seq 273 nt   +upstreamnt  +downstreamnt
atgtgcataggcgttcccggccagatccgcaccattgacggcaaccaggcgaaagtcgac
gtctgcggcattcagcgcgatgtcgatttaacgttagtcggcagctgcgatgaaaacggt
cagccgcgcgtgggccagtgggtactggttcacgttggctttgccatgagcgtaattaat
gaagccgaagcacgcgacactctcgacgccttacaaaacatgtttgacgttgagccggat
gtcggcgcgctgttgtatggcgaggaaaaataa

DBGET integrated database retrieval system