KEGG   Escherichia coli KO11FL: EKO11_1047
Entry
EKO11_1047        CDS       T01718                                 

Definition
(GenBank) hydrogenase accessory protein HypB
  KO
K04652  hydrogenase nickel incorporation protein HypB
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eko03110]
    EKO11_1047
Chaperones and folding catalysts [BR:eko03110]
 Other chaperones and cochaperones
  Others
   EKO11_1047
SSDB
Motif
Pfam: cobW Arf Zeta_toxin T2SSE AAA_19 MobB Viral_helicase1
Other DBs
NCBI-ProteinID: ADX49682
Position
complement(1104152..1105024)
AA seq 290 aa
MCTTCGCGEGNLYIEGDEHNPHSAFRSAPFAPAARPKMKITGIKAPEFTPSQTEEGDLHY
GHGEAGTHAPGMSQRRMLEVEIDVLDKNNRLAERNRARFAARKQLVLNLVSSPGSGKTTL
LTETLMRLKDSVPCAVIEGDQQTVNDAARIRATGTPAIQVNTGKGCHLDAQMIADAAPRL
PLDDNGILFIENVGNLVCPASFDLGEKHKVAVLSVTEGEDKPLKYPHMFAAASLMLLNKV
DLLPYLNFDVEKCIACAREVNPEIEIILISATSGEGMDQWLNWLETQRCA
NT seq 873 nt   +upstreamnt  +downstreamnt
atgtgtacaacatgcggttgcggtgaaggcaacctgtatatcgagggtgatgaacataac
cctcattccgcgtttcgtagcgcgccatttgccccggcggcacgcccgaagatgaaaatc
accggcattaaagcgcctgaatttacccccagccagactgaagaaggcgacctgcattac
ggtcatggcgaagcgggcactcacgcgccgggcatgagccagcgtcggatgctggaagtc
gaaattgacgtgctggacaaaaataaccgtctggctgaacgcaaccgcgcgcgctttgct
gcccgcaagcaactggtgctcaacctggtttccagccctggttccggtaaaaccaccctg
ctgacggaaaccttaatgcgcctgaaagacagcgttccgtgcgcagttattgaaggcgat
cagcaaaccgtgaacgatgccgcacgcattcgcgctaccggcacaccagcgattcaggtg
aacactggtaaaggctgccaccttgacgcacagatgattgccgacgccgcaccgcgtctg
ccactggacgataacggtattctgtttatcgaaaacgttggcaacctcgtatgcccggcc
agcttcgatctcggtgaaaaacacaaagtagcggtcctttccgttaccgaaggtgaagac
aaaccgctgaaatatccgcatatgtttgccgccgcctcgctgatgctgctcaacaaagtt
gaccttttgccgtatctcaactttgacgttgagaagtgcatcgcctgcgcacgcgaagtc
aatccagaaattgaaatcatccttatttccgccaccagcggcgaagggatggaccagtgg
ctgaactggctggagacacagcgatgtgcatag

DBGET integrated database retrieval system