KEGG   Escherichia coli KO11FL: EKO11_1048
Entry
EKO11_1048        CDS       T01718                                 

Definition
(GenBank) hydrogenase nickel insertion protein HypA
  KO
K04651  hydrogenase nickel incorporation protein HypA/HybF
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:eko03110]
    EKO11_1048
Chaperones and folding catalysts [BR:eko03110]
 Other chaperones and cochaperones
  Others
   EKO11_1048
SSDB
Motif
Pfam: HypA zinc_ribbon_9 zinc-ribbons_6 zf-B_box
Other DBs
NCBI-ProteinID: ADX49683
Position
complement(1105028..1105378)
AA seq 116 aa
MHEITLCQRALELIEQQAAKHGAKRVTGVWLKIGAFSCVETSSLAFCFDLVCRGSVAEGC
KLHLEEQEAECWCETCQQYVTLLTQRVRRCPQCHGDMLQIVADDGLQIRRIEIDQE
NT seq 351 nt   +upstreamnt  +downstreamnt
atgcacgaaataaccctctgccaacgggcactggaattgatcgaacagcaggccgcaaaa
cacggcgcaaaacgcgtaactggggtctggctcaaaattggcgcattttcttgtgtcgaa
accagctctcttgccttttgttttgatctggtttgccgcggcagcgtggcggaaggttgt
aaactgcacctcgaagaacaagaggccgaatgctggtgtgaaacatgccaacagtatgtg
acgctactgacccagcgcgtccgccgctgtccacagtgtcatggtgacatgctacagatt
gtggcagacgacggtttacagattcggcggatagaaatagaccaggagtga

DBGET integrated database retrieval system