KEGG   Escherichia coli KO11FL: EKO11_1049
Entry
EKO11_1049        CDS       T01718                                 

Definition
(GenBank) formate hydrogenlyase regulatory protein HycA
  KO
K15833  formate hydrogenlyase regulatory protein HycA
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99973 Transcription
    EKO11_1049
SSDB
Motif
Pfam: HycA_repressor RNA_pol_Rpb2_45
Other DBs
NCBI-ProteinID: ADX49684
Position
1105590..1106051
AA seq 153 aa
MTIWEISEKADYIAQRHRRLQDQWHIYCNSLVQGITLSKARLHHAMSCAPDKELCFVLFE
HFRIYVTLADGFNSHTIEYYVETKDGEDKQRIAQAQLSIDGMIDGKVNIRDREQVLEHYL
EKIAGVYDSLYTAIENNVPVNLSQLVKGQIPAA
NT seq 462 nt   +upstreamnt  +downstreamnt
atgactatttgggaaataagcgagaaagccgattacatcgcacagcggcatcgtcgccta
caggaccagtggcacatctactgcaattcgctggttcaggggatcacgttatcgaaagcg
cgcctgcatcacgccatgagctgcgcgccggacaaagaactctgtttcgtcctttttgaa
cattttcgtatttacgtcaccctggcggatggctttaacagccacaccatcgagtattac
gtcgaaacaaaagatggcgaagacaaacagcggattgcgcaggcgcaactgagcattgac
ggcatgattgatggcaaggtcaacatccgcgatcgcgaacaggttctggaacactatctc
gaaaaaatcgctggcgtttacgacagcttatacaccgccattgaaaacaatgtgccggtg
aatttaagccaactggtaaagggacaaatcccggcagcatga

DBGET integrated database retrieval system