KEGG   Escherichia coli KO11FL: EKO11_1050
Entry
EKO11_1050        CDS       T01718                                 

Definition
(GenBank) small subunit of hydrogenase-3, iron-sulfur protein
  KO
K15827  formate hydrogenlyase subunit 2
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    EKO11_1050
SSDB
Motif
Pfam: Fer4 Fer4_7 Fer4_6 Fer4_9 Fer4_16 Fer4_11 Fer4_10 Fer4_3 Fer4_21 Fer4_2 Fer4_8 Fer4_13 Fer4_4 ETF_QO Fer4_15
Other DBs
NCBI-ProteinID: ADX49685
Position
1106176..1106787
AA seq 203 aa
MNRFVIADSTLCIGCHTCEAACSETHRQHGLQSMPRLRVMLNEKESAPQLCHHCEDAPCA
VVCPVNAITRVDGAVQLNESLCVSCKLCGIACPFGAIEFSGSRPLDIPANANTPKAPPAP
PAPARISTLLDWVPGIRAIAVKCDLCSFDEQGPACVRMCPTKALHLVDNTDIARVSKRKR
ELTFNTDFGDLTLFQQAQSGEAK
NT seq 612 nt   +upstreamnt  +downstreamnt
gtgaatcgttttgtaattgctgactccacgctctgtatcggctgccacacttgtgaggcc
gcctgttcagagacgcatcgccagcacggcctgcaatcaatgccgcgcctgagagtgatg
ctgaatgaaaaagaatctgcgccgcagctctgtcaccactgtgaagatgcaccctgcgcg
gtggtctgcccggttaacgccatcacccgcgttgatggggccgtgcagttgaatgaaagc
ctgtgcgtaagctgcaagctgtgcggcatcgcctgcccgtttggcgcaattgaattttcc
ggcagccgtccgctggatattcctgcaaatgccaataccccgaaagcgccaccggcaccg
cctgctccggcgcgtatcagtacgctgcttgactgggtgccgggtattcgcgcgatcgcc
gtcaaatgtgacctttgtagctttgatgaacaaggtccggcctgcgtgcggatgtgcccg
accaaagccctgcatctggtggataacaccgatatcgcccgcgttagcaaacgtaagcgt
gagctgacctttaacacggactttggcgatctcaccttgtttcagcaggctcaaagtgga
gaggctaaatga

DBGET integrated database retrieval system