KEGG   Escherichia coli KO11FL: EKO11_1051
Entry
EKO11_1051        CDS       T01718                                 

Definition
(GenBank) NADH/Ubiquinone/plastoquinone (complex I)
  KO
K15828  formate hydrogenlyase subunit 3
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    EKO11_1051
SSDB
Motif
Pfam: Proton_antipo_M
Other DBs
NCBI-ProteinID: ADX49686
Position
1106784..1108610
AA seq 608 aa
MSAISLINSGVAWFVAAAVLAFLFSFQKALSGWIAGIGGAVGSLYTAAAGFTVLTGAVGV
SGALSLVSYDVQISPLNAIWLITLGLCGLFVSLYNIDWHRHAQVKCNGLQINMLMAAAVC
AVIASNLGMFVVMAEVMALCAVFLTSNSKEGKLWFALGRLGTLLLAIACWLLWQRYGTLD
LRLLDMRMQQLPLGSDIWLLGVIGFGLLAGIIPLHGWVPQAHANASAPAAALFSTVVMKI
GLLGMLTLSLLGGNAPLWWGIALLVLGMITAFVGGLYALMEHNIQRLLAYHTLENIGIIL
LGLGAGVTGIALEQPALIALGLVGGLYHLLNHSLFKSVLFLGAGSVWFRTGHRDIEKLGG
IGKKMPVISIAMLVGLMAMAALPPLNGFAGEWVIYQSFFKLSNSGAFVARLLGPLLAVGL
AITGALAVMCMAKVYGVTFLGAPRTKEAENATCAPLLMSVSVVALAICCVIGGVAAPWLL
PMLSAAVPLPLEPANTTVSQPMITLLLIACPLLPFIIMAICKGDRLPSRSRGAAWVCGYD
HEKSMVITAHGFAMPVKQAFAPVLKLRKWLNPVSLVPGWQCEGSALLFRRMALVELAVLV
VIIVSRGA
NT seq 1827 nt   +upstreamnt  +downstreamnt
atgagcgcaatttccctgatcaatagcggcgtggcgtggtttgtcgccgccgctgttctg
gcatttctcttttcttttcaaaaggcgctaagcggctggatagccggaattggcggcgcg
gttggtagcctgtatacggcagccgcgggctttactgtgctgactggcgcggttggcgtg
agcggtgcgctgtcgctggtaagctacgatgtgcaaatctctccgcttaacgcgatttgg
ctgattacgctcggtctgtgcggtctgtttgtcagcctctacaacattgactggcatcgc
cacgcgcaggtgaagtgcaacggcttgcagatcaatatgttgatggctgccgccgtctgc
gccgtcatcgccagcaacctcggcatgttcgtggtaatggctgaagtcatggccttgtgt
gcggtgttccttaccagcaacagcaaagagggcaaactgtggtttgcgctggggcgtctt
ggcactctgctgctggcgattgcttgctggctgctgtggcagcgttatggcacgctggat
ctgcgcctgctggatatgcgtatgcaacagctgccgctcggttccgatatctggctgctc
ggtgtgattggctttggcctgctggccgggattattccgctgcacggctgggtgccgcag
gcacatgctaacgcctctgcgccagctgccgcgttgttttctacggtagtcatgaaaatt
ggcctgctgggcatgttaaccctgtcactgcttggcggtaatgcaccgctgtggtggggg
atcgcgctgctggtgctcggcatgatcaccgcgttcgtcggtggtctgtatgcgttgatg
gaacacaacatccagcgcctgctggcttaccacaccctggaaaatatcggcattattctg
ctggggctgggcgctggcgtaacgggtatcgcgctcgaacaaccggcactgattgctctt
ggcctggtcggtggtctgtaccatctgcttaaccatagcctgttcaaaagcgtactgttc
ctcggagcggggagcgtctggttccgtaccggtcatcgcgatatcgaaaaactcggtggt
attggcaagaaaatgccggttatctccatcgccatgttagtcgggttaatggcaatggct
gcgctgccgccgctgaacgggtttgccggggaatgggttatctatcaatccttcttcaaa
ctgagcaatagcggcgcgtttgttgcccgtctgctggggccgctgctcgctgtgggtctg
gcaattaccggtgcgctggcggtgatgtgtatggcgaaagtctatggcgtcacgttcctc
ggcgcgccgcgtaccaaagaagccgaaaacgccacctgtgcgccgctcctgatgagcgta
agcgtagtggcactggcgatttgctgcgtaattggcggtgttgctgcgccgtggctgctg
ccgatgctctctgctgctgtacctctgcctctggagcctgctaacaccaccgtttctcaa
ccaatgatcacattgctgctgattgcctgcccgctgctgccattcatcattatggcgatt
tgcaaaggcgaccgcctgccgtcacgttcccgcggtgcggcctgggtgtgcggctacgac
catgaaaaatcaatggtgattaccgctcacggttttgccatgccggtgaaacaggcgttt
gcgccagtgctgaaactgcgcaaatggctgaatccggtgtcgctggtgccgggctggcag
tgcgaaggtagtgcgttgctgttccgccggatggcgctggttgaactggcggtactggtg
gtgattattgtttcacgaggagcctga

DBGET integrated database retrieval system