KEGG   Escherichia coli KO11FL: EKO11_1052
Entry
EKO11_1052        CDS       T01718                                 

Definition
(GenBank) respiratory-chain NADH dehydrogenase subunit 1
  KO
K15829  formate hydrogenlyase subunit 4
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    EKO11_1052
SSDB
Motif
Pfam: NADHdh DUF1516
Other DBs
NCBI-ProteinID: ADX49687
Position
1108613..1109536
AA seq 307 aa
MSVLYPLIQALVLFAVAPLLSGITRVARARLHNRRGPGVLQEYRDIFKLLGRQSVGPDAS
GWVFRLTPYVMVGVMLTIATALPVVTVGSPLPQLGDLITLLYLFAIARFFFAISGLDTGS
PFTAIGASREAMLGVLVEPMLLLGLWVAAQVAGSTNISNITDTVYHWPLSQSIPLVLALC
ACAFATFIEMGKLPFDLAEAEQELQEGPLSEYSGSGFGVMKWGISLKQLVVLQMFVGVFI
PWGQMETFTAGGLLLALVIAIVKLVVGVLVIALFENSMARLRLDITPRITWAGFGFAFLA
FVSLLAA
NT seq 924 nt   +upstreamnt  +downstreamnt
atgagtgttttatatccgttaattcaggcgctggtgttatttgccgttgcgccgctgctc
tccggtattacccgcgtggcgcgcgcccgtctgcataaccgtcgtgggccgggtgtgttg
caggagtatcgtgacattttcaaactgctgggccgccagagcgttggcccggatgcctcc
ggctgggtgttccgcctgacgccgtatgtgatggtgggcgtcatgctgactatcgctact
gcgctgccggtggtgaccgtcggttctccgctgccgcaactgggtgatttaatcacctta
ctgtatctctttgccatcgcgcgtttcttctttgccatttctggtctggataccggtagc
ccgtttaccgctatcggcgcgagccgtgaagcgatgcttggcgtgctggtcgaaccgatg
ctgctgcttggtctgtgggttgccgcacaggttgccggttccaccaacatcagcaacatc
accgacaccgtttatcactggccgctgagccagagcatcccgctggtactggcgctttgt
gcctgtgcgttcgccacctttatcgaaatgggcaaactgccgttcgacctggcggaagcc
gagcaggagctgcaggaaggcccgctctctgaatacagcggcagcggctttggcgtcatg
aaatggggtatcagcctgaaacagctggtggtgctgcagatgttcgtcggcgtatttatc
ccgtggggacagatggaaaccttcaccgccggtgggctgctgctggcgctggtgattgcc
atcgtcaaactggtcgtcggcgtcctggttatcgcgctgttcgaaaacagcatggcccgt
ctgcgtcttgatattactccgcgcattacctgggctgggtttggctttgcatttttagcg
ttcgtctccttgctggcggcgtga

DBGET integrated database retrieval system