KEGG   Escherichia coli KO11FL: EKO11_1053
Entry
EKO11_1053        CDS       T01718                                 

Definition
(GenBank) NADH dehydrogenase (ubiquinone) 30 kDa subunit
  KO
K15830  formate hydrogenlyase subunit 5
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99982 Energy metabolism
    EKO11_1053
SSDB
Motif
Pfam: Complex1_49kDa Complex1_30kDa NiFeSe_Hases
Other DBs
NCBI-ProteinID: ADX49688
Position
1109554..1111263
AA seq 569 aa
MSEEKLGQHYLAALNEAFPGVVLDHAWQTKDQLTVTVKVNYLPEVVEFLYYKQGGWLSVL
FGNDERKLNGHYAVYYVLSMEKGTKCWVTVRVEVDANKPEYPSVTPRVPAAVWGEREVRD
MYGLIPVGLPDERRLVLPDDWPDELYPLRKDSMDYRQRPAPTTDAETYEFINELGDKKNN
VVPIGPLHVTSDEPGHFRLFVDGENIIDADYRLFYVHRGMEKLAETRMGYNEVTFLSDRV
CGICGFAHSTAYTTSVENAMGIQVPERAQMIRAILLEVERLHSHLLNLGLACHFTGFDSG
FMQFFRVRETSMKMAEILTGARKTYGLNLIGGIRRDLLKDDMIQTRQLAQQMRREVQELV
DGLLSTPNMEQRTVGIGRLDPEIARDFSNVGPMVRASGHARDTRADHPFVGYGLLPMEVH
SEQGCDVISRLKVRINEVYTALNMIDYGLDNLPGGPLMVEGFTYIPHRFALGFAEAPRGD
DIHWSMTGDNQKLYRWRCRAATYANWPTLRYMLRGNTVSDAPLIIGSLDPCYSCTDRMTV
VDVRKKKSKVVPYKELERYSIERKNSPLK
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgtctgaagaaaaattaggtcaacattatctcgccgcgctgaatgaggcatttccgggc
gtcgtgctggaccacgcctggcagaccaaagatcagctgaccgtgaccgtgaaggtgaac
tacctgccggaagtggtggagtttctctactacaagcagggtggctggctgtcggtgctg
tttggtaacgacgaacgcaaactgaatggtcattacgccgtttattacgtgctgtcgatg
gagaagggcaccaagtgttgggtaacggttcgcgtcgaagttgacgccaacaaaccggag
tatccgtccgtgacgccgcgcgttccggcggcggtgtggggcgagcgcgaagtgcgcgat
atgtacggtttgattccggttggtctgccggatgaacgtcgtctggtgctgccggatgac
tggccggatgaactttatccgctgcgtaaagacagcatggattatcgtcagcgtccggca
ccgactaccgatgctgaaacctacgagttcatcaatgaactgggcgacaagaaaaacaac
gtcgtgccgattggtccgctgcacgtcacttctgacgaaccgggccacttccgtctgttc
gtcgatggcgaaaacattatcgacgccgactaccgtctgttctacgttcatcgcggcatg
gaaaaactggcggaaacccgtatgggttacaacgaagtgaccttcctctctgaccgtgtg
tgcgggatctgcggctttgcccacagcaccgcctacaccacgtcggtagaaaacgcgatg
ggtattcaggtgccagaacgtgcgcagatgatccgcgccattctgctggaggtggaacgc
ctgcactcgcatctgctcaacctcggtctcgcctgccactttaccggctttgactccggc
tttatgcagttcttccgcgtgcgtgaaacctccatgaaaatggcagagatcctcaccggt
gcgcgtaaaacctacggcctgaacctgatcggcgggattcgtcgcgatctgttgaaagat
gacatgatccagacccgccagctggcgcaacagatgcgtcgtgaagtgcaggagctggtg
gatgggctgctgagtacgccgaacatggaacagcgcaccgtcggcattggtcgtctggac
ccggaaatcgcccgcgatttcagtaacgttggcccgatggttcgcgccagcggtcacgcc
cgcgatactcgcgccgatcacccgtttgtcggttatggcctgctgccaatggaagtccac
agcgagcagggctgcgacgttatttcccgtctgaaagtgcgtatcaacgaagtttatacc
gcgctgaacatgatcgactacggtctggataacctgccgggcggtccgctgatggtggaa
ggctttacctacattccgcaccgtttcgcgctgggctttgccgaagcgccgcgcggcgac
gatatccactggagcatgaccggcgacaaccagaagctgtaccgctggcgctgccgtgcc
gcgacctacgcgaactggccgaccctgcgctacatgctgcgcggtaacaccgtttccgat
gcgccgctgattatcggtagcctggacccttgctactcctgtaccgaccgcatgaccgtg
gtcgatgtgcgtaagaaaaagagcaaagtggtgccgtacaaagaactcgagcgttacagc
attgagcgtaaaaactcgccgctgaaataa

DBGET integrated database retrieval system