KEGG   Escherichia coli KO11FL: EKO11_3152Help
Entry
EKO11_3152        CDS       T01718                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
eko  Escherichia coli KO11FL
Pathway
eko00020  Citrate cycle (TCA cycle)
eko00640  Propanoate metabolism
eko00660  C5-Branched dibasic acid metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
eko01130  Biosynthesis of antibiotics
eko01200  Carbon metabolism
Module
eko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EKO11_3152
   00640 Propanoate metabolism
    EKO11_3152
   00660 C5-Branched dibasic acid metabolism
    EKO11_3152
Enzymes [BR:eko01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     EKO11_3152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ADX51738
Structure
PDB: 

Position
complement(3279624..3280790)
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFARYGLPAPVGYACTTPREAEEAASKIGAGPWVVKCQVHAGGRGKAGGV
KVVNSKEDIRAFAENWLGKRLVTYQTDANGQPVNQILVEAATDIAKELYLGAVVDRSSRR
VVFMASTEGGVEIEKVAEETPHLIHKVALDPLTGPMPYQGRELAFKLGLEGKLVQQFTKI
FMGLATIFLERDLALIEINPLVITKQGDLICLDGKLGADGNALFRQPDLREMRDQSQEDP
REAQAAQWELNYVALDGNIGCMVNGAGLAMGTMDIVKLHGGEPANFLDVGGGATKERVTE
AFKIILSDDKVKAVLVNIFGGIVRCDLIADGIIGAVAEVGVNVPVVVRLEGNNAELGAKK
LADSGLNIIAAKGLTDAAQQVVAAVEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacttacatgaatatcaggcaaaacaactttttgcccgctatggcttaccagcaccg
gtgggttatgcctgtactactccgcgcgaagcagaagaagccgcttcaaaaatcggtgcc
ggcccgtgggtagtgaaatgtcaggttcacgctggtggccgcggtaaagcgggcggtgtg
aaagttgtaaacagcaaagaagacatccgtgcttttgcagaaaactggctcggcaagcgt
ctggtaacgtatcaaacagatgccaatggccaaccggttaaccagattctggttgaagca
gcgaccgatatcgctaaagagctgtatctcggtgccgttgtagaccgtagttcccgtcgc
gtggtctttatggcctccaccgaaggcggcgtggaaatcgaaaaagtggcggaagaaact
ccgcacctgatccataaagttgcgcttgatccgctgacaggcccgatgccgtatcaggga
cgcgagctggcgttcaaactgggtctggaaggtaaactggttcagcagttcaccaaaatc
ttcatgggcctggcgaccattttcctggagcgcgacctggcgttgatcgaaatcaacccg
ctggtcatcaccaaacagggcgatctgatttgcctcgacggcaaactgggcgctgacggc
aacgcactgttccgccagcctgatctgcgcgaaatgcgtgaccagtcgcaggaagatccg
cgtgaagcacaggctgcacagtgggaactgaactacgttgcgctggacggtaacatcggt
tgtatggttaacggcgcaggtctggcgatgggtacgatggacatcgttaaactgcacggc
ggcgaaccggctaacttccttgacgttggcggcggcgcaaccaaagaacgtgtaaccgaa
gcgttcaaaatcatcctctctgacgacaaagtgaaagccgttctggttaacatcttcggc
ggtatcgttcgttgcgacctgatcgctgacggtatcatcggcgcggtagcagaagtgggt
gttaacgtaccggtcgtggtacgtctggaaggtaacaacgccgaactcggcgcgaagaaa
ctggctgacagcggcctgaatattattgcagcaaaaggtctgacggatgcagctcagcag
gttgttgccgcagtggaggggaaataa

DBGET integrated database retrieval system