KEGG   Escherichia coli KO11FL: EKO11_3157Help
Entry
EKO11_3157        CDS       T01718                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
eko  Escherichia coli KO11FL
Pathway
eko00020  Citrate cycle (TCA cycle)
eko00190  Oxidative phosphorylation
eko00650  Butanoate metabolism
eko01100  Metabolic pathways
eko01110  Biosynthesis of secondary metabolites
eko01120  Microbial metabolism in diverse environments
eko01130  Biosynthesis of antibiotics
eko01200  Carbon metabolism
Module
eko_M00009  Citrate cycle (TCA cycle, Krebs cycle)
eko_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
eko_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:eko00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    EKO11_3157
   00650 Butanoate metabolism
    EKO11_3157
  Energy metabolism
   00190 Oxidative phosphorylation
    EKO11_3157
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADX51743
Structure
PDB: 

Position
complement(3287616..3287963)
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVF
TLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaacgcctccgcattaggacgcaatggcgtacatgatttcatcctcgttcgc
gctaccgctatcgtcctgacgctctacatcatttatatggtcggttttttcgccaccagt
ggcgaactgacatatgaagtctggatcggtttcttcgcctctgcgttcaccaaagtgttc
accctgctggcgctgttttctatcttgattcatgcctggatcggcatgtggcaggtgttg
accgactacgttaaaccgctggcattgcgcctgatgctgcaactggtgattgtcgttgca
ctggtggtttacgtgatttatggattcgttgtggtgtggggtgtgtga

DBGET integrated database retrieval system