KEGG   Escherichia coli KO11FL: EKO11_3688
Entry
EKO11_3688        CDS       T01718                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K11903  type VI secretion system secreted protein Hcp
Organism
eko  Escherichia coli KO11FL
Pathway
eko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EKO11_3688
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_3688
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_3688
SSDB
Motif
Pfam: T6SS_HCP SBBP
Other DBs
NCBI-ProteinID: ADX52261
Position
complement(3850372..3850890)
AA seq 172 aa
MPTPCYISITGQTQGNITAGAFTADSVGNIYVQGHEDEMLVQEFLHNVTVPTDPQSGQPA
GQRAHKPFIFTVALNKAVPLMYNALASGEMLPTTELHWWRTSVEGKQEHYFTTRLTDSTI
VDMKLHMPHCQDPAKREFTQLLEVSLAYRKIEWEHVKSGTSGADDWRAPLEA
NT seq 519 nt   +upstreamnt  +downstreamnt
atgccaacaccgtgttatatctccatcactggtcagacccagggaaatattactgcaggt
gcatttaccgctgattctgtcggcaacatctatgtgcaggggcacgaagacgagatgctg
gtgcaggaattcctgcataacgttactgtcccgaccgatcctcagtccggtcagcctgcg
ggtcagcgtgctcacaagcctttcatttttaccgtggcgctgaacaaagcggttccgctg
atgtacaacgcactggcctccggcgaaatgctgccaaccactgaacttcactggtggcgt
acctctgtggagggcaaacaggagcattatttcactacccgcctgactgattcgacgatt
gtcgatatgaaactgcatatgccgcattgccaggacccggcgaaacgcgagttcacccag
ttgctcgaagtttcactggcctaccgcaaaattgaatgggaacacgtcaaatctggcacc
tccggtgccgacgactggcgcgcaccgctggaagcataa

DBGET integrated database retrieval system