KEGG   Escherichia coli KO11FL: EKO11_3696
Entry
EKO11_3696        CDS       T01718                                 

Definition
(GenBank) type VI secretion lipoprotein, VC_A0113 family
  KO
K11906  type VI secretion system protein VasD
Organism
eko  Escherichia coli KO11FL
Pathway
eko03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:eko00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    EKO11_3696
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_3696
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_3696
SSDB
Motif
Pfam: T6SS-SciN
Other DBs
NCBI-ProteinID: ADX52269
Position
3858495..3859019
AA seq 174 aa
MNRKAFLACVLMCVILTGCETAKKISEVIKNPDIQVGSLKEQPSEITVTLLTEPDTNTNA
EGESAAVDVQLVYLTDDSKLLAADYDQIASTPLPDVLGKNYIDHQDFNLLPDTIKTLPPV
KLDEKTQFIGVVAYFSDDQATEWKQIETVEGTGHHYRLLVHVRQSSIEMKKEDE
NT seq 525 nt   +upstreamnt  +downstreamnt
atgaacaggaaggcgtttctggcctgcgtgctgatgtgcgtcatattaaccggctgcgaa
acggcgaaaaaaatcagtgaggtgatcaaaaacccggatatccaggtcgggagcctgaag
gagcaaccttcggaaataaccgtcaccctgctgaccgaaccggacaccaataccaatgcg
gaaggtgaatcagccgccgtggatgtgcaactggtgtacctgactgacgactcaaaattg
ctggcagccgactatgaccagatagccagtacgccgctaccggatgtgctgggtaaaaac
tatatcgaccaccaggatttcaacctgttgccggacaccatcaaaaccctgccgccggta
aagctggatgagaaaacgcagtttattggtgtcgtggcctatttctccgatgaccaggcc
actgaatggaaacaaatcgagacggtggaaggaaccggccaccattaccgcctgctggtg
catgtacgtcaaagcagcatcgaaatgaaaaaagaggatgaataa

DBGET integrated database retrieval system