KEGG   Escherichia coli KO11FL: EKO11_3703
Entry
EKO11_3703        CDS       T01718                                 

Definition
(GenBank) ImpA domain protein
  KO
K11911  type VI secretion system protein VasL
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:eko02044]
    EKO11_3703
Secretion system [BR:eko02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   EKO11_3703
SSDB
Motif
Pfam: VasL ImpA_N
Other DBs
NCBI-ProteinID: ADX52276
Position
3869646..3870998
AA seq 450 aa
MNSNVLTQTIVTGSDPRGLPEFSAIREEINKASHPSQPELNWKLVESLALAIFKANGVDL
HTATYYTLARTRTQGLAGFCEGAELLAAMVSHDWDKFWPQGGPARTEMLDWFNSRTGNIL
RQQISFAESDLPLIYRTERALQLICDKLQQVELKRVPRVENLLYFMQNTRKRLEPQLKSN
TENAAQTTVRTLIYAPETQASSTPEAVVPPLPGLPEMKVEVRSLTENPPQASVIKQGSTV
RGFIAGIACSVAVASALWWWQVYPVQQQLLQVNDTAQGAATVWMASPELENYERRLQQLL
DTSPVQPLETGMQMMRVADSRWPESLQQQQASTQWNEALKTRAQSSPQLRGWLQTRQDLH
AFADLVMQREKEGLTLSYIKNVIWQAERGLGQETPVESLLTQYQDARAQKQNTDALEKQI
NERLEGVLSRWLLLKNNVMPEAATGTTAEK
NT seq 1353 nt   +upstreamnt  +downstreamnt
atgaatagtaacgtactgacacaaactatcgttaccggcagtgacccgcgcgggctgccg
gaattcagtgccatccgcgaggaaataaacaaagccagccacccgtcacagcctgagctg
aactggaaactggtggagtcgctggcactggcgatttttaaagccaacggtgtggattta
cacaccgccacctactatacgcttgcccggacacggacacagggactggcgggattctgc
gaaggtgcggaactgctggcggcaatggtaagccacgactgggataagttctggccgcag
ggcggcccggcgcgtactgaaatgctggactggtttaactcccgaaccggcaatattctg
cgtcagcaaatctcctttgcggaatccgacctaccactgatctaccgcacagagcgggca
ttgcagcttatctgcgataagctccagcaggtggaactgaagcgcgttccgcgcgtggag
aatctgctctattttatgcagaacacgcgtaaacggcttgaaccccagctgaagagtaac
actgagaacgccgcacagaccacggtcagaacgctgatttatgccccggaaacacaggca
tcttccacaccagaagcggtagtgcctcccctgcccggcctgcctgagatgaaagtggaa
gtgcgcagtctgacagagaatcccccacaggccagtgtgataaagcaaggcagtacggta
agagggtttatcgcagggatcgcctgttcagtggctgtcgcctcagcattgtggtggtgg
caggtctatccggtacagcagcaactgttacaggttaacgacaccgctcagggcgcagca
acggtgtggatggcctcacctgaactcgaaaactatgagcgcaggctgcaacaacttctt
gatacctccccggtacagccgctggaaaccgggatgcagatgatgcgtgttgccgacagt
cgctggccggaaagcctgcaacagcaacaggcctcgacacaatggaatgaggcactcaaa
acccgcgcacagagtagcccgcagttgcgtggctggttgcagacccgccaggacttacat
gcttttgcagatctagtgatgcagcgcgagaaagagggactaaccctttcctatatcaaa
aatgtcatctggcaggcggagcggggactggggcaggaaacacccgttgagtctctgttg
acgcagtaccaggatgcccgtgcgcagaagcagaatacagatgcgctggaaaaacaaatt
aatgagcgactcgaaggcgtgttaagccgctggctgctgctgaagaataacgtcatgcca
gaggcggcaaccggtaccacggccgaaaaataa

DBGET integrated database retrieval system