KEGG   Escherichia coli KO11FL: EKO11_3704Help
Entry
EKO11_3704        CDS       T01718                                 

Definition
(GenBank) type VI secretion system effector, Hcp1 family
  KO
K06887  uncharacterized protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    EKO11_3704
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: T6SS_HCP
Motif
Other DBs
NCBI-ProteinID: ADX52277
Position
3871022..3871504
Genome map
AA seq 160 aa AA seqDB search
MANISYLSLSGETQGLISAGCSTLDSVGNKAQPEHKDQIMVYALMHSISRSQNVNHHELI
ITKPVDKSSPLLAKALSDNEKMAICEFILYRTSKAGIYQPYYKINLSKARISSIDFVTPH
AVLEKELEPQERIAFIYEDISWEHTLAGTNAMSKWQDRVQ
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatataagttatttatctttgagtggagagacacaagggctgatttcagcaggt
tgctcaacgcttgattctgtcggaaacaaagcgcagccagaacataaagatcagatcatg
gtttatgcgttaatgcattccatctcaagaagtcaaaatgtcaatcatcatgaattaatt
atcaccaaaccggttgataaatcctcaccattgctggcaaaagcacttagtgacaatgaa
aaaatggcaatatgtgaatttatactctaccgaaccagtaaagcgggtatttaccagcct
tattataaaataaatctgtcaaaagcccgaatatcaagtattgattttgtcacaccgcat
gctgtcctggaaaaagaactggaaccacaggagagaattgcctttatttatgaagatatt
tcctgggagcatacgttagccggtacgaatgcaatgagtaaatggcaggatcgtgtacag
taa

DBGET integrated database retrieval system