KEGG   Escherichia coli KO11FL: EKO11_3862Help
Entry
EKO11_3862        CDS       T01718                                 

Definition
(GenBank) ApaG domain protein
  KO
K06195  ApaG protein
Organism
eko  Escherichia coli KO11FL
Brite
KEGG Orthology (KO) [BR:eko00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    EKO11_3862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 DUF4354
Motif
Other DBs
NCBI-ProteinID: ADX52435
Position
4057102..4057479
Genome map
AA seq 125 aa AA seqDB search
MINSPRVCIQVQSVYIEAQSSPDNERYVFAYTVTIRNLGRAPVQLLGRYWLITNGNGRET
EVQGEGVVGVQPLIAPGEEYQYTSGAIIETPLGTMQGHYEMIDENGVPFSIDIPVFRLAV
PTLIH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgatcaattcgccccgagtgtgtattcaggttcaaagcgtctacattgaggcacaatct
tcacctgataatgaacgttacgtttttgcttataccgtaaccatacgcaatctggggcga
gcgccagtgcagttgttggggcgttactggctgatcaccaatggcaatggccgtgaaacc
gaagtccagggcgaaggagtggttggcgtccagccacttatcgcgcctggcgaagagtac
cagtacaccagcggtgcaatcattgaaaccccgctgggcaccatgcagggtcactacgaa
atgatcgatgaaaatggcgtccctttcagcatcgacattcccgtattccgactcgccgtt
cccacactcattcattaa

DBGET integrated database retrieval system