KEGG   Eutypa lata: UCREL1_10234Help
Entry
UCREL1_10234      CDS       T03103                                 

Definition
(GenBank) putative aromatic-l-amino-acid decarboxylase protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ela  Eutypa lata
Pathway
ela00350  Tyrosine metabolism
ela00360  Phenylalanine metabolism
ela00380  Tryptophan metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    UCREL1_10234
   00360 Phenylalanine metabolism
    UCREL1_10234
   00380 Tryptophan metabolism
    UCREL1_10234
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    UCREL1_10234
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ela04147]
    UCREL1_10234
Enzymes [BR:ela01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     UCREL1_10234
    4.1.1.105  L-tryptophan decarboxylase
     UCREL1_10234
Exosome [BR:ela04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   UCREL1_10234
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC
Motif
Other DBs
NCBI-ProteinID: EMR62818
UniProt: M7SF23
Position
Unknown
AA seq 523 aa AA seqDB search
MDSKQFKEAAISSIDDIVNYYETIEERRVASTVEPGYLRKLLPDEAPQDGEAWADIQKDI
EAKILPGITHWQSPNFAAWFPSSSSYPAMLGEMYSTALTGAAFNWICSPAVTELETIVLD
WLARAFGLPECYLSTGPTNGGGVIHGTASEAIATVIVAARDKYLREATSHIAADDEEGRE
DAWAERRGRLVALGSAATHSATKKGAQIAGVRYRSVPVHAADGYKMTGASLRTTILELRA
RGLEPFFLTATMGTTDTCAVDDMDSIADVLAELGPAAGGGGGGGGPHGGEVWVHVDAAYA
GVALLCPEHRGLVGERALGRFHSFNTNLHKWLLVNFDCSVLYVRDRRPLVDALSVTLPIL
RNRHTDAGLVTDYRDWQIPFGRRFRSLKVWFVVRTYGVRGLQAHIRKHVGFAEAFAGLLE
GRPDLFEIVTGPRFALTVFKLKGGGGGGGGGGEGASTTLEEQNALTKKAYELILAEGKIF
LSSTVVGGVYAIRHNPATPFVEERHVREHFEIFVEAAEKVLSQ
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggattcgaaacagtttaaagaagcggctatttcgtccattgacgacattgtcaactat
tatgagaccatcgaggaacgacgagttgcttcaaccgtcgagcccgggtatttaagaaaa
cttctcccggacgaggcacctcaagatggagaagcgtgggcagatatccagaaggacatc
gaggccaagatcctccccggcatcacgcattggcagtctcccaacttcgcagcgtggttc
ccctcgtcgagcagctacccagcgatgctaggcgagatgtactcgacggccctgacgggg
gccgcgttcaactggatctgctcgccggcggtgacggagctcgagaccatcgtgctggac
tggctggcgcgggccttcggcctcccggagtgctacctctcgacgggacccaccaacggc
ggcggcgtgatccacggcacggcgtcggaggccatcgcgacggtcatcgtggccgcgcgc
gacaagtacctgcgcgaggcgacgtcccacatcgccgcggacgacgaggaggggcgggaa
gacgcgtgggccgagcgccgcggccgcctcgtcgccctcggcagcgccgccacccacagc
gccaccaagaagggcgcccagatcgccggcgtccgctaccggtccgtgccggtccacgcc
gccgacgggtacaagatgacgggggcgtcgctgcggactacgatcctggagctgcgcgcc
agggggctcgagcccttcttcctgacggccacgatgggcaccaccgacacgtgcgccgtc
gacgacatggactccatcgccgacgtgctggcggagctgggcccggcggcgggcggcggc
ggcggcggtggtggtccgcacggcggcgaggtctgggtgcacgtggacgcggcgtacgcg
ggggtggcgctgctgtgcccggagcaccgcgggctggtgggcgagcgggcgctggggcgc
ttccacagcttcaacacgaacctgcacaagtggctgctggtcaacttcgactgcagcgtg
ctgtacgtgcgggaccggcggccgctggtcgacgcgctgagcgtgacgctgccgatcctg
cgcaaccgccacacggacgcggggctcgtgaccgactaccgcgactggcagatcccgttc
gggcggcgcttccgcagcctcaaggtctggttcgtcgtacgcacgtacggcgtccggggc
ctgcaggcccacatccggaagcacgtcggcttcgccgaggccttcgcgggcttgctggag
ggccgccccgacctgttcgagatcgtcacgggcccgcgcttcgccctgacggtgttcaag
ctcaagggcgggggcggaggcggaggcggaggcggagagggcgcgtccacgaccctggag
gagcagaatgcgctgacgaagaaggcgtacgagctcatccttgctgagggcaagatattc
ctctccagtactgtggttggaggcgtctacgcgatccggcataaccccgcgacaccgttt
gtagaagagcggcacgtgcgagagcatttcgagatcttcgtcgaggccgcagagaaggtc
ctctctcagtag

DBGET integrated database retrieval system