KEGG   Eutypa lata: UCREL1_10531Help
Entry
UCREL1_10531      CDS       T03103                                 

Definition
(GenBank) putative dihydroxyacetone synthase protein
  KO
K17100  dihydroxyacetone synthase [EC:2.2.1.3]
Organism
ela  Eutypa lata
Pathway
ela00680  Methane metabolism
ela01100  Metabolic pathways
ela01200  Carbon metabolism
Module
ela_M00344  Formaldehyde assimilation, xylulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09102 Energy metabolism
   00680 Methane metabolism
    UCREL1_10531
Enzymes [BR:ela01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.3  formaldehyde transketolase
     UCREL1_10531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transketolase_N Transket_pyr Transketolase_C DXP_synthase_N E1_dh GSHPx
Motif
Other DBs
NCBI-ProteinID: EMR62490
UniProt: M7T743
Position
Unknown
AA seq 875 aa AA seqDB search
MTPSLETLNNAANGGQVKPLVKSMGGITGVAGLQLDGADKHGLVLGVFRAYVADLCEQFK
GGHPGSAMGMAAIGVALYKYVMRYSPTNCDYFNRDRFVLSNGHACLWQYLFMHLVGVKSM
TTDQLKSYHSSRYDSICPGHPEIEHEGIEVTTGPLGQGVANAVGMAIATKQLAATYNREG
LEVVNNMTYTMIGDACLQEGVGLEAVSLAGHWKLNNLCIIYDNNSVTCDGTADVANSEDI
NEKMKATGFKVVDILDGHSNVGVIVQALLEARTSDKPTFINIRTIIGFGSLRAGDAKTHG
AALGADDIVNIKKSFGLNPEEHFYIPQEVYDFFSDAVDRGDKLVEEWSATVKNHSETFPD
LGAEFKLRVEGKMPGDWTKYIPTKEALPTAPTASRKSAGLVGNPLSENLKNFLVGTADLT
PSCNVAYGNKVDFQSPDLRTACNLDGDYSGRYLHYGIREHAMASISNGIAAFNKGTFLPV
TSSFFMFYLYAAPGVRMGALQGLQQIHIATHDSIGTGEDGPTHQPIALAALYRAMPNVLY
IRPCDSEEVAGAFISAIKATETPTIISLSRQNLTQYPPYSSRDGVAKGAYVFVENESFDV
TLIGVGSEMGFTMQTKELLEKEYSVQARVVSFPCMRLFEQQSKEYKKSVLKPQSGKPIVV
IEAYAVTGWERYADASFSMRRFGKSVPGAAAYEFFGFNAKNIAPKVKDLVNEVKRDGIGC
LRGDFRDLNGEQLLSTAQAFLSSFNRFTPESVVAYRSASCIHRLLPTTLQSPPRSNAEYA
AFVVHLQAVMPDFRLQLWEGQVPIVDEVNRTVVILLKSHSKTDVGVYENEYTWMLKFNGD
GSEIDEIIEFADSQYTAEWIIKLQKAVEERQEVKV
NT seq 2628 nt NT seq  +upstreamnt  +downstreamnt
atgacaccctcgctcgagacgttgaacaatgctgctaatggagggcaagtgaagccatta
gtcaagtcgatgggaggcataactggtgtcgcaggcctccaacttgacggtgcagacaag
catggcttagttctcggcgtcttccgtgcatatgttgctgatttatgtgaacaatttaag
ggcgggcatccaggttcagccatgggcatggcagcaatcggtgttgctttgtacaagtat
gtcatgagatactccccgacaaactgtgactacttcaaccgagatcggtttgtattatcg
aatggccatgcatgcttatggcaataccttttcatgcaccttgttggtgtcaagagcatg
acgacagaccaactcaagagctatcattcatcccgatatgactcgatttgtcccggtcac
cctgagattgagcatgaaggtatcgaggtcacgactggcccccttggacagggcgtagcc
aatgccgttggtatggcaatagcaacaaagcaacttgctgccacttataaccgagaaggg
ctcgaagtcgtcaacaacatgacgtatacgatgatcggagacgcttgtctacaggaaggt
gtcgggctcgaggctgtctcgttggccggccactggaaattaaacaacctctgtatcatc
tacgacaacaactctgtcacttgcgacggaacggccgatgtggcgaacagcgaagacatc
aacgagaagatgaaagccactggcttcaaagtggtcgatatccttgatggccattcgaac
gtcggcgttattgttcaagccctgctcgaagcgcgaacgagcgacaagccaaccttcatc
aatattcggactattattggattcggctcactcagagctggtgatgccaagactcatggc
gcagcattaggagcggacgacatcgtgaatatcaagaaatcattcggcctgaacccagag
gagcatttctatatccctcaggaggtgtatgactttttctctgacgcggtcgaccgaggc
gacaagctcgtagaggaatggagcgctactgtgaagaatcattccgagacattccctgac
ctcggagccgaatttaagcttcgtgttgaggggaagatgccaggtgactggaccaaatat
attccaacgaaggaggcgctgccgacggcgccaacagcgtctcggaaatcggccgggttg
gtcggcaacccgctcagtgaaaacttgaagaatttcctggtcggtacagcagacttaaca
ccgtcttgtaatgttgcatatggcaacaaggttgactttcaatcacccgacctgcgtact
gcttgcaacctcgacggcgattattcgggtcgctatctccactatggcattagagagcac
gcgatggcctcgatttccaacggcatagctgcttttaataaaggtacattcttgccagta
accagttccttcttcatgttctacctttacgccgcccctggtgtgcgaatgggtgcccta
caaggattgcagcaaatccacattgccacgcatgacagtatcggcactggcgaagatggg
cctacccatcagcctatagcattggcagcgctttaccgagccatgcccaatgtactatac
atccggccttgcgactcagaggaggtagcgggggcgttcatcagcgctatcaaggctacc
gaaacacccaccatcatctctctatctcgacaaaacctgacgcagtacccaccatactct
tcgcgagacggagtggcaaagggcgcgtatgtcttcgtcgagaatgaaagttttgacgtc
acccttatcggagttggttcggagatgggcttcacgatgcagaccaaggagcttctagaa
aaggagtacagtgttcaggctcgagtggtctcattcccatgcatgcgtctcttcgagcaa
caatcaaaggagtacaagaaatcggttttgaagccccaatcggggaagccaattgtggtg
atcgaagcatatgctgtgactggatgggagaggtacgctgatgcgtcgttctccatgcgt
cgttttggcaagagtgttcctggcgctgccgcgtatgagttcttcgggttcaacgccaag
aacattgctcccaaagtcaaggatttagtaaatgaagtgaagagagacggaattggttgt
ctgaggggcgattttagggacctaaatggagagcagctcctcagcacggcgcaggcattc
ctatcatccttcaatcggttcacaccggagtcggtcgtggcgtaccgcagcgcctcgtgt
atacatcgtctactcccgacgacattgcagtccccgccccgcagcaacgcagagtacgcg
gcgtttgtcgtccacctacaagccgtgatgccagatttccggttacaattatgggagggc
caggtgcctatagtcgacgaggtcaaccgcactgtcgttattctcctcaaatcacattct
aagaccgatgtcggcgtatacgagaacgaatacacctggatgctgaagttcaatggcgac
ggttcggagatcgacgagattatcgagtttgccgatagtcaatatacggctgagtggatt
atcaagttacagaaggctgttgaggaaaggcaggaagtgaaagtctga

DBGET integrated database retrieval system