KEGG   Eutypa lata: UCREL1_2094Help
Entry
UCREL1_2094       CDS       T03103                                 

Definition
(GenBank) putative geranylgeranyl pyrophosphate synthetase protein
  KO
K00804  geranylgeranyl diphosphate synthase, type III [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ela  Eutypa lata
Pathway
ela00900  Terpenoid backbone biosynthesis
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
ela01130  Biosynthesis of antibiotics
Module
ela_M00367  C10-C20 isoprenoid biosynthesis, non-plant eukaryotes
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    UCREL1_2094
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ela01006]
    UCREL1_2094
Enzymes [BR:ela01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     UCREL1_2094
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     UCREL1_2094
    2.5.1.29  geranylgeranyl diphosphate synthase
     UCREL1_2094
Prenyltransferases [BR:ela01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   UCREL1_2094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt
Motif
Other DBs
NCBI-ProteinID: EMR70871
UniProt: M7TLQ2
Position
Unknown
AA seq 401 aa AA seqDB search
MDPAAAAAVLPERTEGHHLAPSAPLSPQSPNAIPPRTSSTGYAVPHPPSKSALRPLPESN
WLSQSSSRHRKTSSATAIPLTGMQGNGPPDPARFATEDYNIIIQRQWTTQKEKVLQGPYD
YLYSIPGKDFRSLMVASFNAWLEVPKESLDIITKVVGMLHTSSLLIDDVEDNSVLRRGLP
VTHSIFGTAQTINSANYVYFCALQELQKLKNPKATDVYTEELLNLHRGQGMDLFWRDTLT
CPTEEDYLEMVGNKTGGLFRLAIRLMQAESKTAIDCVPLVHVLGLIFQIEDDYKNLSDVQ
YTENKGFAEDLTEGKFSFPIIHSIRSDPNSLQLLNILKQKTTDAEVKRYAVKYMEGTGSF
EYTRRVLEVLIGRARKIADEIDAGRGKSQGVHKILDKMVLA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggatcctgcagcagctgccgcggtgttgcctgaaaggaccgagggccatcatctcgct
cccagcgcccctttatctccccagtctccgaacgccattcctcctcgaacctcttcgacc
ggctatgccgtaccccatcctccctccaagtccgccttacgacctctccctgaatccaac
tggcttagtcagagttcttcaagacaccggaagacttcgtctgctacagctatccccttg
acaggcatgcaaggcaacggacctcctgatcccgcgcgctttgcgaccgaggactacaat
attataatacaaaggcaatggactactcaaaaggagaaggttcttcaaggtccttatgat
tacctatattctatccctggcaaggacttccgtagtctaatggtcgcttcctttaacgct
tggctagaggtccccaaggagagcttggatatcataaccaaggtggttggcatgcttcac
acttcatcgttactcatagacgatgtcgaagataattcagttctgcgacgtggtctacca
gtaacacatagtattttcggaaccgcacagaccatcaactcggctaattacgtctacttc
tgtgccctccaggagctccagaagttaaagaaccccaaagccaccgatgtatacactgag
gagttactcaaccttcatcgaggacaggggatggaccttttctggagagacacattaacc
tgcccgacagaagaggactacctggagatggttgggaacaagaccggcgggctgttccgc
cttgccatccggctcatgcaggccgagtcgaaaacggccatcgactgcgtgccgctggtg
cacgtcctggggctcatcttccagatcgaggacgactacaagaacctgtcggacgtccag
tacacggagaacaaggggttcgccgaggacctgactgagggcaagttctcgttccccatc
atccacagcatccggtcggaccccaacagcctgcagctcctcaatatcctgaagcagaag
accaccgacgccgaggttaagcgctacgccgtcaagtacatggagggcaccggcagcttc
gagtacacgcgccgcgtcctcgaggtcctgatcggccgcgcccgcaagatcgccgacgag
atcgacgccggccgcggcaagagccagggcgtccacaagatcttggataagatggtcctt
gcgtag

DBGET integrated database retrieval system