KEGG   Eutypa lata: UCREL1_2551
Entry
UCREL1_2551       CDS       T03103                                 

Definition
(GenBank) putative delta -sterol reductase protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ela  Eutypa lata
Pathway
ela00100  Steroid biosynthesis
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Module
ela_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    UCREL1_2551
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     UCREL1_2551
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-ProteinID: EMR70429
UniProt: M7SV16
Position
Unknown
AA seq 484 aa
MAPKTKKTEPEHGYEFGGPFGTAAITFGLPVLCYIFTFACNDVTGCPAPSLLNPKSLSLE
QLKTEVEWPEDGILGLVSWDATFATFGYYAFNFLLYKILPATEVEGTQLRSGGRLKYRFN
ALASTLTTLVIAAAGTITQGAEFPLWTFIADNYVQILTTNILIAYALATFVYVRSFSVKP
GKNADNRELAAAGHTGNLMYDFYIGRELNPRVAIPLLGEVDIKSYMELRPGLLGWVILNW
AFVAKQYRNYGWVSDSSVFVSVVQMIYVLDSKYMEPAILTTMDITTDGFGFMLSFGDLVW
VPFMYSTQVRYLSTYPVVLGPWGLAGVAAVLATGYGIFRASNSQKNTFRTNPDDPSVQHI
KYIETKTGTRLMVSGWWGVARHINYLGDWLQAFPYSIPTGFAGYAILSAGSGAEDALKMR
DGREVVQGEAKYWGMIFTYFYIVYFAVLLIHRDRRDDEKCARKYGADWEKYKKVVKYRIV
PGLY
NT seq 1455 nt   +upstreamnt  +downstreamnt
atggcgccaaagacgaagaagaccgagcctgaacatggctatgaattcggtggaccattc
ggtactgccgccatcacttttggtcttcccgtcctctgttacatttttaccttcgcctgc
aacgatgtcaccggttgtcctgcgccctccctcttgaaccccaagtccctctctctcgaa
cagttaaaaaccgaggtcgaatggcctgaagatggcatcttgggattagttagttgggac
gctactttcgctactttcggttactatgccttcaacttcctcctatacaagatcctacca
gctaccgaggtcgagggaacgcagctgagatcgggcggccgacttaagtaccgattcaac
gccctcgcatccaccctgaccaccctcgtcatagccgccgcaggcaccatcacccagggc
gccgagttccctctctggaccttcatcgccgacaactacgtgcagatcctgacgaccaac
atcctgatcgcctacgcgctggccaccttcgtctacgtgcgcagcttctccgtgaagccg
ggcaagaacgcggacaaccgcgagctggcggccgcgggccacacggggaacctgatgtac
gacttctacatcgggcgggagctgaacccgcgggtggcgatcccgctgctcggcgaggtc
gacatcaagtcgtacatggagctacggcccggcctgctcgggtgggtgatcctgaactgg
gccttcgtcgccaagcagtaccgcaactacgggtgggtgtcggacagctccgtcttcgtc
tccgtcgtccagatgatctacgtcctcgacagcaagtacatggagcccgccatcctgacc
accatggacatcacgaccgacgggttcgggttcatgctctcgttcggcgacctcgtctgg
gtgcccttcatgtactcgacccaggtgcgctacctatccacgtatcccgtcgtgctcggg
ccctggggcctggcgggcgtagccgccgtcctcgccactgggtacggcatcttccgcgcc
agcaactcccagaagaacaccttccgcacgaaccccgacgacccctccgtgcagcacatc
aagtacatcgagacgaagacggggacccgcctcatggtctcgggctggtggggcgtcgcg
cgccacatcaactacctgggcgactggctgcaggccttcccctactcgatccccaccggc
ttcgcgggctacgccatcctcagcgcggggagcggcgccgaggacgcgctcaagatgcgc
gatgggcgggaggtcgtccagggcgaggccaagtactggggcatgatcttcacgtacttc
tacatcgtgtactttgcggtgctcctgatccatcgcgatcgtagggatgatgagaagtgc
gcgaggaagtacggtgccgattgggagaagtataagaaggttgttaagtatcggattgtg
ccggggttgtactga

DBGET integrated database retrieval system