KEGG   Eutypa lata: UCREL1_3270Help
Entry
UCREL1_3270       CDS       T03103                                 

Definition
(GenBank) putative phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ela  Eutypa lata
Pathway
ela00564  Glycerophospholipid metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Module
ela_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UCREL1_3270
Enzymes [BR:ela01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     UCREL1_3270
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PSDC PS_Dcarbxylase Biotin_lipoyl_2
Motif
Other DBs
NCBI-ProteinID: EMR69705
UniProt: M7TSS8
Position
Unknown
AA seq 455 aa AA seqDB search
MVHQHGDEHEIPEKHRVQRNGAWLPTDHRVQHEWMKAQVEHVNSHPKKELVPVLREFRDL
IESEPRIYMYFNEMWDEVPHKKPYDRDPTGEMRQIRGYKHMLDVLNHVLTRPPEWHDAAA
GVGMVGVPMVAIFDYVMATPSGHAAFLDPDVNKMLKKVLNEWGKFLQSPESASVLGSHSQ
GWFSQHGQKDLLEVANTPLKTSHEKFEDVYICDPKAKHYGYKSWDDFFTRHFHEGVRPVA
APDNDNVVANACESRPYNVARGAKLRDRFWVKGQPYSVLDMLGHDPLARQFDGATVYQAF
LSALSYHRWHAPVSGKVVRAFVRDGTYFSEPLFEGQGRGQGKGPSSSEIDVRGISVAQGY
LTSLAARAVIFIEADNPALGLVAFVGVGMDEVSTCDVTVREGQHVAKGDEIGMFHFGGST
HCLLFRKGVEVDGFPDLDGGGNVPVRGNICVVKNT
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggtccaccagcacggcgacgaacatgaaattccggagaagcaccgcgtccaacgaaat
ggtgcctggctgcctacggaccaccgggtccaacacgaatggatgaaggcccaagtagag
cacgtgaacagccaccccaaaaaggagctcgtcccggtgcttcgggaattccgggacctg
atcgagagcgagccgcgcatctacatgtacttcaacgagatgtgggacgaggtgccgcac
aagaaaccctatgacagagatccgacgggcgagatgaggcagattcgcggctacaagcac
atgctcgacgtgctgaaccacgtcctcactcgtccgccagagtggcacgatgccgcggct
ggcgtcggcatggttggtgtacctatggttgccatttttgactacgtgatggctacgcct
agtgggcacgctgctttcttggacccggacgtcaataaaatgctcaagaaggtattgaat
gaatggggcaaattcctgcagtcccctgagtcggccagtgtgctcgggtctcacagccag
ggctggttctcgcagcacgggcaaaaagacctcctagaggtggccaacacgccactgaag
acatcccacgagaagttcgaggatgtatatatctgcgacccgaaggcgaaacactacggc
tacaagtcctgggacgacttcttcacccgccatttccacgagggcgtacgtcccgtcgcc
gcacccgacaacgacaacgtcgtggccaacgcctgcgagtcgcgcccgtacaacgtggcg
cggggcgccaagctacgcgacaggttctgggtcaaggggcagccgtacagcgtcctcgac
atgctgggccacgaccccctggcccgccaattcgacggcgccaccgtctaccaggccttc
ctgtcggcgctgtcataccaccgctggcacgcgcccgtgagcggcaaggtcgtccgcgca
ttcgtccgcgacgggacgtacttcagcgagccgctgttcgaggggcagggacgaggtcag
gggaagggaccatcatcgtcggagatcgacgtccgcggcatcagcgtcgcccagggctac
ctgacgtcgctggcggcgcgcgccgtcatcttcatcgaggcggacaatccggccttgggg
ctcgtggctttcgtgggtgtcggtatggacgaggtcagcacgtgcgatgtcacggtccgc
gagggccagcacgtcgctaagggggacgagatcgggatgttccacttcggcgggtcgacc
cattgcctgctgttccggaagggggtcgaggtcgacgggtttcctgatctcgacggcggg
ggcaatgtccctgttcggggcaatatctgtgtcgtgaagaatacataa

DBGET integrated database retrieval system