KEGG   Eutypa lata: UCREL1_3548Help
Entry
UCREL1_3548       CDS       T03103                                 

Definition
(GenBank) putative beta-glucosidase 1 protein
  KO
K05349  beta-glucosidase [EC:3.2.1.21]
Organism
ela  Eutypa lata
Pathway
ela00460  Cyanoamino acid metabolism
ela00500  Starch and sucrose metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UCREL1_3548
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    UCREL1_3548
Enzymes [BR:ela01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     UCREL1_3548
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_3_C Glyco_hydro_3 Fn3-like
Motif
Other DBs
NCBI-ProteinID: EMR69432
UniProt: M7SYM3
Position
Unknown
AA seq 769 aa AA seqDB search
MKILSTFVSSALFLQSASGIGYGLNGSDSQFYGQSPPVYPSPIGNGTSNPRWALAYQRAK
TLAGQMTVEEKANITRGFTGTCVGNSGAVPRLGVPPLCFADAPDGIRGQEYVSAFPAGIH
VAATWDRDLMYQYGKALGSEYRGKGINVALGPVAGPLGRVVRGGRNWEGLSNDPYLAGAG
MGMITRGIQDAGVIATPKHFLLNEQEFRRRPGSNDEAISSNVDDRTLHELYMFPFMDSFR
ENAASVMCSYQRVNNSYGCQNSKLLNGLLKTELGFEGFVVSDWAAQYTGIASANGGLDLV
MPDGGYWGQNLTDAVRNGSVSVDRITDMATRILASWYYLGHDNGFPSPAIYSSTTKHEPV
DVQGDHASIIREVGAAGTVLVKNENNALPLQRPTFLCIYGYDATVPSVPWQDPSRFGGGY
GVNFGWETFKGTLITGGGSGGSSPSYVVSPFQAIQERLRKDRGIVRWDFESENPYPPYVN
ADACLVFINAYASESFDRLSLTDESSDRLVNNVAANCSNTIVVIHSTGIRTVDAWIENEN
ITAVLYAGLPGQESGNSLVDVLWGDVSPSGKLPYTVAKQESDYGDVLNSSVSLDKFPQDD
FTEGLFIDYRAFDRDEIKPRFEFGYGLTYTTFEYGDLDAKVAEGANTVPLPDPEVAVISG
GHPALWETIATVTFTLSNTGGVTASEVAQLYLGIPSSEGFDTPARQLRGFQRTPVRPGET
RTVVLSLTRRDLSVWDTVAQQWRLQPGTYQIDVGASSRDLRLQGSLEIV
NT seq 2310 nt NT seq  +upstreamnt  +downstreamnt
atgaagattttgtcgaccttcgtgtcctctgcgctgttcttgcagagcgcatctggtatt
ggatatggcctcaatggttcggattcgcagttctacggccagagtccaccagtctaccca
tccccaattggtaacggcaccagcaatccacgatgggcattggcgtatcagcgtgccaag
accctggctgggcagatgaccgtcgaggagaaagccaacatcacccgcggcttcaccggt
acctgtgtaggcaacagcggcgctgtacctcggctaggagttccacctctgtgtttcgcc
gacgcccccgacggcattcgcgggcaggaatatgtttctgctttcccggccggtattcac
gtagctgctacgtgggatcgcgatctgatgtaccagtatggcaaggcacttgggtccgaa
taccgcggaaagggcatcaatgtggctttaggtccagtggctggccctctaggaagggtt
gtccgcggtggtcggaattgggaaggacttagcaacgacccttatctagctggtgctgga
atgggtatgatcacccggggcattcaggacgcgggtgtcatcgcaacgccgaagcacttt
ctcctgaacgagcaggaattcagacgcaggccaggaagcaacgatgaagcaatcagctcc
aacgtcgatgataggactttgcatgagttgtacatgtttccgttcatggactcgttccgc
gagaacgcggcttcagtcatgtgttcgtatcaacgcgtaaacaattcctatggatgccag
aactccaagctgctgaacggtttgctcaagaccgagctgggttttgaaggattcgttgtc
agtgactgggcagcgcaatacacaggcattgcttcagccaatggcgggttggatctcgta
atgcctgacggcggttactgggggcagaacctaacagacgcagtgcgcaacggatccgtc
agcgttgatcggatcacggacatggcgacacggatcttggctagttggtattaccttggt
catgacaacggcttcccctcgcccgccatttactccagtacgacgaagcatgagccggta
gacgtccaaggagatcatgcttcgatcattcgggaggtgggagcagccggcaccgtgttg
gttaagaatgaaaataacgcactgccgctacaacggccaaccttcctctgcatctacgga
tacgatgctactgtaccatcggtgccgtggcaggacccgtcccgctttggaggtggatac
ggtgtcaacttcggctgggagaccttcaaagggacgttgattacaggcggcgggtcgggc
ggtagtagtccgagctatgtcgtcagccccttccaggccatacaggagcgacttcgaaaa
gataggggaatcgtgcgctgggactttgagtcagagaacccgtatcctccttacgtaaac
gcagacgcctgcctcgtcttcatcaatgcgtacgcctcggaaagcttcgaccgtttgagt
ttgacggacgagtcgagcgaccgactggttaacaacgtcgcggcgaattgctctaacact
atagtggtgattcactcaactggcatccgcaccgtcgacgcgtggatcgagaacgaaaat
atcacagcagtcctctacgcaggacttccggggcaagaaagcggtaacagcttagtggac
gtgctttggggggacgtgagccccagtggcaaattaccctacaccgtcgcgaagcaagag
tcagactacggcgacgtgctcaactcgagcgtatccttagacaagttcccacaggacgac
ttcaccgagggtctattcatcgactaccgtgccttcgaccgagacgagatcaagccgcgt
ttcgaattcgggtatgggttaacgtacacgacgttcgagtacggcgacctggacgctaag
gtagcggaaggcgccaatacggttccactcccagatccagaggtagcagtcatctccggc
ggtcatcccgcgctctgggaaactatagcgactgtgactttcactctgtccaataccggc
ggcgtcacggcttcggaagtggctcagctctacctgggtatcccgagtagcgagggattc
gacacgccggcgcgtcagctacgtggcttccagcggacccccgttcgtccgggcgagacg
cgtacggtggttctctcgcttacccggagagatctcagtgtgtgggacaccgtagcacag
cagtggaggttgcagccggggacgtaccaaatcgacgtcggtgctagtagtagagatcta
cggcttcagggatctttagaaatcgtgtaa

DBGET integrated database retrieval system