KEGG   Eutypa lata: UCREL1_3885Help
Entry
UCREL1_3885       CDS       T03103                                 

Definition
(GenBank) putative h k atpase alpha protein
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
ela  Eutypa lata
Brite
KEGG Orthology (KO) [BR:ela00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ela04147]
    UCREL1_3885
Enzymes [BR:ela01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     UCREL1_3885
Exosome [BR:ela04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   UCREL1_3885
  Exosomal proteins of other body fluids (saliva and urine)
   UCREL1_3885
  Exosomal proteins of colorectal cancer cells
   UCREL1_3885
  Exosomal proteins of bladder cancer cells
   UCREL1_3885
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase Cation_ATPase_N DUF2231 DUF2157 Hydrolase_3 HAD RAMP
Motif
Other DBs
NCBI-ProteinID: EMR69089
UniProt: M7SRJ1
Position
Unknown
AA seq 1057 aa AA seqDB search
MQKSFNIEESKSKDPAAFEKVDDATTKELTTLDWHAISTHEAVRRLGSSTTEGLSDEQVM
RKLKEHGPNAPSPPKSDVFQRYFGYFFKGFGPVLLLGAILVFIAWKPLGDPPAIANMALA
IVLVAVFFIQAGFNIYQDWSSSRVMSSIKSMLPEECLVIRNSAQVSLSAAELVPGDIVCV
KAGNKLPADVRFLQAASDTKFDRSILTGESVPLAATVDSTDDNYLETRCIGMQGTPCVSG
SCVGLVVAIGDKTVFGRIAALTNEPKTKLTSLEKEVIRFVLIIVSIMLTMIAVVLVVWST
YLRKNHPNWISVPNLIVSCVSVAIAFIPEGLPIALTAGLTITANLMRKQKVLCKSLKTVE
TLGSVSVICSDKTGTLTENRMAVTECTIGNHTLSADEAEAEQEGSSAPEMAGIVTSAVGQ
VRALSGLCNAAEFDVATMQQPIEKRHIYGDATDQAILRFSERLGPVHDLRQCWQKTYELA
FNSKNKYMIRAFSLFRRDCLNDTLSYAEANAFQPGDTLLTIKGAPDVLINRCSHFTTNAG
DSHLFDDEMRASFEQVKNQYSSQGKRCILLARRVLRQAEIAIQAGTVQFEDEIQEHAKTD
LTLVGLVAIVDPLRPEIRDVVTTLRGAGIRIFMVTGDFALTALAIAQEAGIISSPSALVD
NVSALPREPPGSRSMDTGTTTMVVRSIAKHSPALPPLARASSSIVVSGPELPGLNEHQWR
ALTSYEEIVFARTTPEQKLRIVREFQRDNVVAMTGDGVNDAPSLKAADVGIAMGGNGAAS
DIAVEAADMVLLDSFESVVAAVQYGRVVFDNLKKVICYLLPAGCFAEFWPVMTNVLFGLP
QILSSFLMIIICCFTDCAAATILSYEKPEADVLLRKPRNVKKDRLVNWQLVAQAYGTIGV
IETLASFAMAYWYLERNGIPFRVLWFSYGILPDSIDPDYYAEKLNVASSIYFVNLVVMEW
FNLLAVRTRRWSIFQQPPIFNKETSNLKLFPAILFALGMAVIWVYIPQIQPVIGSGPVPV
EYWFLPFSFGFFILVLDEARKFLVRNSPQGWIAKAAW
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagtctttcaacatcgaggaatccaagagcaaggatcctgccgcattcgaaaaa
gtcgatgatgccactaccaaggaactgacgacccttgactggcatgcaatatcgacccat
gaggctgtccgccgcctcggatcctcgacgactgagggcctctcggacgaacaggtcatg
cgcaagctcaaagagcacggccccaatgccccttcccctcccaagtcggacgtgttccag
agatacttcggttacttcttcaaaggcttcgggcctgttctgctcctaggcgccatctta
gtgttcatcgcttggaaacccttaggggatcctccagcaattgcaaatatggccttggcc
atcgtcttggttgccgtcttctttatacaggctggtttcaacatataccaggattggagt
tcatcacgggtcatgagctcgattaagagcatgctccctgaagagtgcttggtcatccgc
aacagtgcgcaggtatcgctttccgcggctgagctcgtacctggcgacatcgtctgtgtc
aaggctggcaataagctgccagccgatgtacgcttcctccaggccgcgagcgatactaaa
ttcgataggtccatcctcactggagagtcggtaccccttgcggcgacggttgattccaca
gatgataattacctcgagacgcgctgcattggcatgcagggtactccctgtgtatctggc
tcatgtgtcggattagtcgtggccattggcgacaagacagtctttggacgaatcgcagct
ctaacgaatgagccgaagaccaagctgacctcgttagagaaagaagtgattcgattcgtc
ttgatcattgtctccataatgcttacaatgatcgctgtcgtcctcgtagtctggagcact
tatttaagaaagaaccatccgaactggatcagtgtgccgaatctgattgtgagctgtgtc
agtgtagctattgcattcattcccgaaggtctgcctatcgctctgactgctggtttgact
ataaccgcgaacctgatgcgaaagcagaaggtcttgtgtaaatcgctgaagacggttgag
actcttgggtcagtgtcagtcatttgctctgataagacagggactctcacagagaaccgg
atggcagttaccgaatgcaccatcggcaaccacactctcagtgcggatgaggcggaggct
gagcaggaaggtagcagtgctccggagatggctggcatcgtgaccagtgctgtcggccag
gttcgtgctctatctggtctctgtaacgcggcagagtttgatgtcgccactatgcaacag
cccattgaaaagcgccacatctacggagacgctacagaccaagccatactcaggttttca
gaacgattaggtcccgtccatgaccttcgccaatgctggcagaaaacctacgagctagcc
ttcaacagcaagaataagtacatgattagggctttctctctattcaggcgagactgcttg
aacgacacgctctcctatgccgaggcaaatgcgttccaacccggcgatacactcttgacc
atcaaaggggcgccggatgtcctcataaaccgctgctcgcactttaccaccaacgcaggc
gattcgcacctctttgacgatgagatgcgcgccagcttcgagcaagtcaagaaccagtac
agcagccagggcaagcgctgcatcctgctggcgcgccgggtgctccgccaggccgagata
gcgatccaggctggcaccgtccagttcgaggatgagatccaagagcacgccaagacggat
ctcacgctcgtcgggctcgtcgccatcgtcgaccccctccgccctgagatccgcgatgtc
gtcacgacgctccgcggggccggcattcgtatttttatggtaaccggcgacttcgcccta
accgctctagccatcgcccaagaagccggaatcatcagcagtcctagcgccctggtagac
aacgtatcggcactcccacgagaaccgcccggatcgcgatcgatggacacgggaacaacg
acaatggtagtgagatctatagcgaagcactcaccagccctcccaccattggcgcgggct
tcctcctccatcgtggtcagcgggcccgagctaccagggctaaacgagcatcaatggcga
gcgctaacctcgtacgaggagatcgtattcgcgcggacgacgcccgagcagaagctgcgc
atcgtacgggagttccagagggacaacgtcgtggccatgacgggcgacggagtcaacgac
gcgccgtcgctgaaggcggccgacgtcgggatcgcgatgggtggtaacggggccgcctcg
gacatcgcggtcgaggccgccgacatggtgctgctcgactcgttcgagtccgtcgtcgcg
gccgtgcagtacggccgcgtcgtcttcgacaacctcaagaaggtcatctgctacctgttg
cccgcggggtgcttcgccgagttctggcccgtcatgacgaatgtcttgtttgggctgccg
cagatcctttcttcgtttctcatgattattatctgctgctttaccgactgcgccgctgcg
accatcttgtcgtacgagaagccggaagccgatgttcttctacgcaagccacgcaacgtt
aagaaagaccggctcgtcaactggcagctcgttgcccaagcgtacgggactatcggcgtg
atcgaaactctagcatctttcgctatggcctactggtatttagagcgcaacggaatacca
ttccgcgtgctgtggttctcctacggtatacttccggattccatcgacccggattactac
gcggagaagctcaatgtggcatcctcgatctacttcgtcaacctggttgtcatggaatgg
ttcaaccttctcgcggtccgcacaagacggtggagcatcttccagcaacccccgattttc
aacaaggagacctcaaacctcaagctcttccccgccattctgttcgcccttggcatggct
gtcatctgggtctatatcccccagatccagcctgtcatcgggtcgggtccagtgccggtc
gagtattggttcttgccattttccttcggcttttttatcctggtgctcgatgaggcgcgc
aagttcttggtgcgaaacagcccgcagggctggatagccaaggctgcttggtaa

DBGET integrated database retrieval system