KEGG   Eutypa lata: UCREL1_4421Help
Entry
UCREL1_4421       CDS       T03103                                 

Definition
(GenBank) putative cytosolic phospholipase a2 zeta protein
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
ela  Eutypa lata
Pathway
ela00564  Glycerophospholipid metabolism
ela00565  Ether lipid metabolism
ela00590  Arachidonic acid metabolism
ela00591  Linoleic acid metabolism
ela00592  alpha-Linolenic acid metabolism
ela01100  Metabolic pathways
ela01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    UCREL1_4421
   00565 Ether lipid metabolism
    UCREL1_4421
   00590 Arachidonic acid metabolism
    UCREL1_4421
   00591 Linoleic acid metabolism
    UCREL1_4421
   00592 alpha-Linolenic acid metabolism
    UCREL1_4421
Enzymes [BR:ela01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     UCREL1_4421
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B Borrelia_P83 Presenilin
Motif
Other DBs
NCBI-ProteinID: EMR68562
UniProt: M7SWC2
Position
Unknown
AA seq 722 aa AA seqDB search
MILPDWSKSIPRQVRKLQGELSMAPGSLADIIWQEAHDPFIHPEIRYSAKVRVSDDLCNE
EKEFLTRRKRVATAALARYLGLDEKDINPDDVPTIAICGSGGGLRALVAGTGSLLATQED
GLLDCVTYTSGVSGSCWLQALFHSSLTDGRLDRLIDHMKARIGVHFAYPPVAFSSVTSAP
TNKLLLNSMVEKLRGDPNASFGLVDIYGILLAARLLVPRGELGVNDRDFKLSNQRDYVKY
GQNPLPIYTAVRHEIPDQGGPLDSDGKMSEEAKEIARQEAWFQWFELTPYEFFCEEFSAG
IPTWALGRKFNDGKDVPPESGFHLPELRMPILMGVFGSAFCATLSHYYREVRPLVKSLTG
FSALDEMIYTHNQDLEKVHPFDPAQIPNFVYNMEGKLRFTTPTKVANSEYIQLMDAGMSN
NLPIYPLLRPGRDIDVIVAFDASADVKTDNWLSVADGYARQRGIKGWPVGVGWPKATESP
KKVEQQLDAAQADSAAEAERRLQEAQKDKGQDTKTKKADDGKDKKKKKGQEQQTPPAETK
EPSEKAQENISHPETSDLGYCTIWVGSTSERSSEPPPPPSKALAPARKKGPAAADHNKND
NDNDNDDEDPSWQQLRSPDAGLAIVYLPLLANPRVPGVDPARSDYLSTWNFAYTPDQVDD
VVALARANYDEGRDQVRGCVRAVYERKKRLREEREDEGSRDRYRRLVRLGINDRLGEGDH
FS
NT seq 2169 nt NT seq  +upstreamnt  +downstreamnt
atgatcctccctgactggtctaaatccatcccgagacaggttcggaagctccagggggag
ctatccatggcacctggctcgctagctgacataatatggcaagaggcccacgatccattc
atccatcccgaaatccgctattccgctaaggtgcgcgtttcggatgatctctgcaacgag
gagaaggagttcctcactcggcggaaaagagtagccacggcagctttggcgagatatctg
ggtttagacgagaaggacattaaccccgacgatgttcccacaatcgcaatatgtggttcc
gggggaggattacgagctttggtagctggaacaggctcgctactagccacgcaagaggat
ggattactcgactgtgtgacatataccagcggtgtgagcggatcatgctggcttcaggct
ctctttcactcgtctctcactgatggccgactcgaccgtctcatagatcacatgaaagcg
cggataggagtgcacttcgcgtacccacctgttgccttctcatccgtcacatcagctcct
accaacaaattacttctaaatagcatggtggaaaagctcaggggtgatcccaatgcaagt
ttcggactagtcgacatctacggaattctcctcgcagcaagactgctagttccgaggggt
gaactgggcgtaaatgaccgggacttcaaactgtccaaccagcgagactacgtgaagtac
ggtcagaacccattgcctatatacaccgcggtgaggcacgagatacccgatcaaggtggt
ccactagactcggacgggaaaatgtcggaggaggcgaaggagatcgcgcgacaggaagcg
tggtttcaatggttcgaactgacgccgtatgagttcttctgcgaggagttcagcgcgggc
atacctacgtgggcgctaggtcgcaaattcaacgacgggaaagacgtaccaccggagagc
ggttttcacctccctgaactgcgcatgcccatattgatgggggtcttcggctctgcattc
tgcgctacgctcagtcactactatcgcgaagtccggcccctagtgaagagcctcacgggc
ttctctgctctcgacgagatgatctacacgcataaccaagacctggagaaggtccacccg
tttgatccggcgcagatacccaacttcgtctacaatatggaaggcaagctgcgattcacg
acacccaccaaagtcgctaacagcgagtacatccaactgatggacgcgggcatgtcgaac
aacctacccatctaccctctgctccgacccggcagggacatcgacgtcatcgtggcattc
gacgcctccgccgacgtcaagacggacaactggctatcggtcgcagacggttacgcccgc
cagcgcggcatcaagggctggcccgtcggcgtgggctggccaaaagccaccgagtcacct
aagaaagtcgagcaacagctcgacgcagcccaagccgattccgccgccgaagcggagcgc
aggctccaggaagcccagaaggataagggccaagacacaaagaccaagaaagccgacgac
ggaaaggataagaagaagaagaagggacaagaacaacagaccccgccggctgagaccaaa
gaaccctccgagaaggcccaggagaatatctcacacccggagacctcggacctgggctac
tgcacgatctgggtaggcagcacgtcggagcggtcgtcggagccgccgccccctccgtcg
aaggctctcgcaccggcacggaagaaaggccccgccgccgctgaccacaacaaaaacgac
aatgataacgacaacgacgacgaggacccatcgtggcagcagctccgcagcccagacgca
gggctcgccatcgtgtacctgccgctgctggcgaacccgcgcgtgccgggcgtggacccc
gcgcgctccgactacctcagcacgtggaacttcgcgtacacccccgaccaggtcgacgac
gtggtggcgctcgcccgcgccaactacgacgaggggagggaccaggtgcgcgggtgcgtc
cgcgctgtgtacgagcgcaagaagaggctcagggaggagagggaggacgagggctcgagg
gatcgctatcggaggttggttaggctgggtattaatgatcggttgggggagggggatcat
tttagttaa

DBGET integrated database retrieval system