KEGG   Eutypa lata: UCREL1_4540Help
Entry
UCREL1_4540       CDS       T03103                                 

Definition
(GenBank) putative 4-nitrophenylphosphatase protein
  KO
K01101  4-nitrophenyl phosphatase [EC:3.1.3.41]
Organism
ela  Eutypa lata
Brite
Enzymes [BR:ela01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.41  4-nitrophenylphosphatase
     UCREL1_4540
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2
Motif
Other DBs
NCBI-ProteinID: EMR68445
UniProt: M7TNZ5
Position
Unknown
AA seq 308 aa AA seqDB search
MALQPKYLTGDSAAINEFFDQFDVFLFDCDGVLWSGDHLFEGTVETLELLRARGKRVVFV
TNNSTKSRQDYQKKLTAMGIPSRVDEIFASAYSSAVYIARILKLPAPRNKVFVVGESGIE
TELRAEGVPFLGGTDPALRRDITPEDFAGLADGSLLDPDVGVVLAGLDFHINYLKLSMGY
QYLRRGAKFLATNLDSTLPMSHTFFPGAGSISVPLVNMTGEAPIALGKPSQAMMDAIEGK
FQLDRARTCMVGDRLDTDIKFGIQGKLGGTLAVLTGVSTKEHWEKEGAEVVPAYYVDKLS
DLRAAEES
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgcaaccgaaatacctcacgggcgattccgccgccatcaacgagttcttcgac
cagttcgatgtgttcctgttcgactgcgacggcgtgctgtggtcgggggaccacctgttc
gagggcaccgtggagacgctggagctgctgcgggcgcggggcaagcgggtcgtcttcgtg
accaacaactcgaccaagtcgcgccaggactaccagaagaagctgacggcgatggggatc
ccgagccgcgtcgacgagatcttcgcgtcggcctactcgtccgccgtctacatcgcgcgc
atcctgaagctgcccgccccgcgcaacaaggtcttcgtcgtcggcgagagcggcatcgag
accgagctgcgcgccgagggcgtccccttcctcggcggcaccgacccggccctgcgccgc
gacatcacccccgaggacttcgccggcctcgccgacggctcgctcctggaccccgacgtc
ggtgtcgtgctggccggcttggacttccacatcaactacctgaagctgtcgatgggctac
cagtaccttcgccgtggcgccaaattcctcgccacgaatctcgatagcacgctgccgatg
agccacaccttcttccctggcgcggggtccatctccgttccgttagtcaacatgaccggc
gaggcccccattgccctaggcaagcccagccaggcgatgatggatgctatcgagggaaag
ttccagctagaccgggcacgtacttgcatggtaggggatcgcctagacaccgatatcaag
tttggcatacaagggaagcttggcgggacactggctgtcttgacgggcgtaagtacgaag
gagcattgggagaaggaaggcgctgaggtcgtgcctgcatattacgtagacaagctgagc
gatcttcgcgccgcggaagagtcatga

DBGET integrated database retrieval system