KEGG   Eutypa lata: UCREL1_5082Help
Entry
UCREL1_5082       CDS       T03103                                 

Definition
(GenBank) putative nadh-cytochrome b5 reductase protein
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
ela  Eutypa lata
Pathway
ela00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:ela00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    UCREL1_5082
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     UCREL1_5082
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NAD_binding_1 FAD_binding_6 NAD_binding_6 FAD_binding_9
Motif
Other DBs
NCBI-ProteinID: EMR67917
UniProt: M7SUG3
Position
Unknown
AA seq 336 aa AA seqDB search
MFARSAIRAAQPLKRAAFKRTYATEPPKPTGGGSNNALLYGAGAAGAASAGYWYFGSSGA
QKAEAKVKEAVAGPPKKAFLGGDQGFISLLLKDVEIVNHNTKKFIFQLPEEDQVSGMQVA
SALLTKFKPADAEKPVIRPYTPTSDEDKKGYIELVVKKYPNGPMSTHLHDMVPGQRLDFK
GPLPKYPWEANKHKHIALLAGGTGITPMYQLMRAIFKNPEDQTKVTLVFGNVTEEDILLK
REFEELENTYPQRFRAFYMLDQPPKSWPAGGKGFVSKDLLKTVLPEPKEDNIKIFVCGPP
GLYKAISGPKVSPSDQGELTGYLKELGYSKDQVYKF
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgtttgccaggtcagcaatccgcgcagctcagcccttgaagcgcgctgccttcaagcgg
acatacgcgaccgagccgcccaagcccaccggtggtggttcgaacaacgccctcctctac
ggcgccggagccgctggggccgccagcgcgggctactggtacttcgggtcctcgggcgcc
cagaaggccgaggccaaggtgaaggaggcggtggccggcccgccaaagaaggccttcctc
ggcggcgaccagggcttcatctccctgctgctcaaggacgtcgagatcgtcaaccacaac
accaagaagttcatcttccagctgcccgaggaggaccaagtgtcggggatgcaagtcgct
agcgccctcctcaccaagttcaagcctgccgacgccgagaagcccgttatccggccgtac
acccctacaagtgacgaggacaagaaaggctatatcgagctggtcgttaagaagtacccc
aacgggccaatgtcgacgcacttacacgacatggtgccggggcagcggctagacttcaag
gggcccctgcctaagtacccgtgggaggcgaacaagcacaagcacattgcgctgctggcg
ggcgggacgggcatcacgccgatgtaccagctgatgcgggcgatcttcaagaacccagag
gaccagaccaaggtgacgcttgtgttcggcaacgtgaccgaggaggacatcctgctcaag
cgcgagttcgaggagctcgaaaacacgtacccgcagcgcttccgcgccttctacatgctc
gaccagccgcccaagagctggcccgcgggcggcaagggcttcgtctccaaggacctcctc
aagaccgtcctgcccgagcccaaggaagacaacatcaagattttcgtctgcggcccgccc
ggcctgtacaaggccatctccggccccaaggtcagcccctcggaccaaggcgagctgacg
ggctacctcaaggagctcggctactcgaaggaccaggtctacaagttctaa

DBGET integrated database retrieval system