KEGG   Eutypa lata: UCREL1_8516Help
Entry
UCREL1_8516       CDS       T03103                                 

Definition
(GenBank) putative nitrite reductase protein
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ela  Eutypa lata
Pathway
ela00910  Nitrogen metabolism
ela01100  Metabolic pathways
Module
ela_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ela_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ela00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    UCREL1_8516
Enzymes [BR:ela01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     UCREL1_8516
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Fer2_BFD Rieske_2 Rieske NIR_SIR_ferr Pyr_redox_3 K_oxygenase
Motif
Other DBs
NCBI-ProteinID: EMR64510
UniProt: M7TCU9
Position
Unknown
AA seq 1139 aa AA seqDB search
MTVDRRKRVVVVGLGMVGIAFIEKLLKLDARAREYDVIVVGDEPHLAYNRVGLTGFFQHR
KVENLYLNPEEWYATHAPDNKLSYHLNTLVTSIDPAKKSVACANGDVVSYDILVLATGSD
AVLPKHTPGHDANGVFVYRTIEDLQKLIAHGESHKGTVGAVVGGGLLGLEAANAMMDLKS
FEEIKLIERNRWVLSRQLDAEAGALVVEKVADLGVDILLSKRVGEIQTDEANNATGIVFE
DGERMDCSTVCFAIGVRPRDGLARSAGLKCADRGGGILVNNDLSTSAPDIYAIGECASWE
NQTFGLIAPGIEMADVLSFNLTQAKLHQPRAFKRPDLSTKLKLLGVDVASFGDFFADRDG
PSSLPAKAAARKKTAAAADDQKSSSAVKRAVNGLPPPPVKALTYKDPFAQVYKKYLFTPD
GKYLLGGMMIGDTSDYIKLVPMVKSQKELDMPPAQLILGAKKDGNSEEEGADLDDDTQVC
SCHNVSKGDVVHSVKEGGCKTVGDVKACTKAGTGCGGCVPLVTSIFSKAMRDTGAEVTNY
ICAHFSYSRADLYHIVMVKRLRTFQDVMREAGNDGDDGQSSEGCEACKPVVASLFSSLWN
RHVMDRPTHGLQETNDRFLGNIQRNGTFSVVPRVSAGEITPDKLIVIGEVAKKYSLYTKI
TGGQRIDMFGARKQDLLDIWRRLVEAGMESGHAYAKSLRTVKSCVGSTWCRYGVGDSVGM
AVRVEERYKSIRSPHKIKGGVSGCVRECAEAQSKDFGLIATEKGFNIFVAGNGGAKPRHA
ELLAKDVAPSEVIPILDRYLMFYIRTADRLQRTARWIEQLPAPGGLRYLQQVILEDRLGI
CASLEAQMQELVDSFFDEWAEALRSPAIAAKFRQFANTDEGVAGVEIEQDRGQPRPAFWP
KDAAEEDFKTLKDRWTSTAWQPVIEASYFAGADTTPNGISAAIKRGDTQLALWRVKGRYY
ATQQMCPHKRAFALSDGLIGQDLSSSSPPPPPPSNPDNKEKKEEEEPCGDNNTKSQKSPW
ISCPFHKRNYDLSSGACRNDAALSIATFEVEERAADGLVYVKLPPVEELDAALGTSKWMV
RKGDAAAAESSPFAELDKKIGFKGRRAKKPGVNPVADLPMRRPVEVLAGGGGCGGAPEW
NT seq 3420 nt NT seq  +upstreamnt  +downstreamnt
atgacggtagataggaggaaaagagtggtggtcgtcggattgggaatggtcggtatcgcc
ttcatagagaaactcctgaaactagatgccagagccagagaatacgatgttatagttgtc
ggcgacgagcctcacctggcatacaatcgagtgggactcaccggcttcttccagcaccgg
aaagtcgagaatctatacctaaaccccgaggaatggtacgcgacacacgcgccagataat
aagctgagctaccatttgaacacgctcgtcaccagcatcgatcccgcgaagaagagcgta
gcctgcgccaacggcgacgtggtgtcttatgacatcctagtgctggcgaccggctcggat
gccgtgctccccaaacacacgcccggccacgacgccaatggggtgttcgtgtaccggacg
atagaggatctgcagaagctgatcgcgcacggagagtcgcacaaggggaccgtcggcgcg
gtggtcggcggtgggctgctggggctcgaggccgccaacgccatgatggacctgaagtcc
ttcgaagaaatcaagctgatcgagaggaaccggtgggtgctaagccgacaactagatgcc
gaggccggcgcgctggtcgtcgagaaggtcgcggacctcggagtagacatcctgctcagc
aagagagtgggggagatccagacggacgaagcgaacaacgcgaccgggatcgtcttcgaa
gacggcgagcggatggactgctcaaccgtatgcttcgccatcggcgtacggcccagggac
ggcctggcgagaagcgccggcctcaagtgcgcggaccggggaggcggcatcctcgtcaac
aacgacctgagcacgagcgctcccgatatctacgccataggcgagtgcgcgagctgggag
aaccagacgttcggcctgatcgcgcccggcatcgagatggccgacgtgctgtccttcaac
ctcacccaagccaagctgcaccagccgcgcgccttcaagcggccagacctcagcacgaaa
ctaaagctcctcggcgtcgacgtggcgagcttcggcgacttcttcgcggaccgagacggc
cccagctctctaccggcaaaggctgcggcgagaaagaagaccgcggcggcggcggatgac
cagaagagcagcagcgccgtcaagagagcggtcaacgggctcccacccccgccagtaaag
gcgctcacgtataaggatcccttcgcgcaggtgtacaagaagtacctcttcacgcccgac
ggtaaatacctcctggggggcatgatgatcggcgacacgtcggactacatcaagctggtg
ccgatggtgaagagccagaaggagctcgacatgccgccggcgcagctaatcctcggtgcc
aagaaagacggtaatagcgaggaggagggcgccgacctggacgacgacacgcaggtgtgc
tcgtgccacaacgtgtcgaagggggatgtggtccacagcgtcaaggagggcggctgcaag
acggtcggcgacgtcaaggcgtgcacgaaggccggcacgggctgcgggggctgcgtgccg
ctcgtgacgagcatcttcagcaaggcgatgcgggacacgggggccgaggtgacgaactac
atctgcgcgcacttcagctactcgcgcgccgacctgtaccacatcgtgatggtgaagcgg
ctgcggacgttccaggacgtgatgcgcgaggccgggaacgacggcgacgatgggcagtcg
tcggagggctgcgaggcgtgcaagcccgtcgtggcgagcctcttctcgtcgctgtggaac
cgccacgtcatggaccggcccacgcacggcctgcaggagaccaacgaccggttcctgggc
aacatccagcgcaacggcaccttcagcgtcgtgccgcgcgtctcggcgggcgagatcacc
cccgacaagctaatcgtcatcggcgaggtggcgaagaagtacagcctgtacacgaagatc
acgggagggcagcgcatcgacatgtttggtgcgagaaagcaagatctgctggatatctgg
cggcggcttgtggaggccgggatggagagcggtcatgcctacgctaagtctctgcggacg
gtcaagagctgcgtgggctctacctggtgtcggtacggagttggggatagcgtcggtatg
gcggtgcgggtggaggagcggtataagagcatccgcagcccgcacaagatcaagggcggt
gtcagcgggtgtgtgcgagagtgtgccgaggcgcagagtaaagacttcggtctcatagca
accgagaagggattcaacatcttcgtagccggcaacggcggcgccaagccgcggcacgcg
gagctgctggccaaggacgtggcgccgtcggaggtgatcccgatcctggaccggtacctg
atgttctacatacggacggcggaccggctgcagcggacggcgcggtggatcgagcagctc
cccgcacccggcgggctccggtacctgcagcaggtcatcctcgaggaccggctggggatc
tgcgcgtcgctcgaggcgcagatgcaggagctggtcgacagcttcttcgacgagtgggcc
gaggccctccggagccccgccatcgccgccaagttccgccagttcgccaacaccgacgag
ggcgtcgccggggtcgagatcgagcaggaccgcggccagccgcgccccgcgttctggccc
aaggacgccgccgaggaggacttcaagaccttgaaggatcgctggactagcaccgcctgg
cagcccgtcatcgaggcgtcgtacttcgcgggcgctgacacgacgcccaatgggatcagt
gccgccatcaagcgcggcgacacacagcttgctctctggcgcgtcaaggggaggtattac
gctacgcagcagatgtgtccgcacaagcgggcattcgcgctatcagacgggctgatcggg
caagatctatcatcatcatcaccaccaccaccaccaccttcaaacccggataataaggaa
aagaaagaagaagaagaaccgtgcggcgacaacaacaccaaaagccaaaaaagcccctgg
atatcatgccccttccacaagcgcaactacgacctcagcagcggcgcgtgccgcaacgac
gccgccctatccatcgccacgttcgaggtcgaggagcgcgccgccgacgggctcgtctac
gtgaagctgcctcccgtggaggagctcgacgccgcgctcggtactagcaagtggatggtg
aggaagggtgatgcggcggcggctgagagcagcccgttcgcggagctcgataagaagatc
ggcttcaagggccgccgtgctaagaagcctggtgtgaaccccgttgcggatctgccgatg
cgcaggcctgtggaggtgttggctggcggtggtggttgcgggggcgcgccggagtggtag

DBGET integrated database retrieval system