KEGG   Elizabethkingia miricola: VO54_00506Help
Entry
VO54_00506        CDS       T03757                                 

Gene name
aldH
Definition
(GenBank) NADP-dependent fatty aldehyde dehydrogenase
  KO
K13877  2,5-dioxopentanoate dehydrogenase [EC:1.2.1.26]
Organism
elb  Elizabethkingia miricola
Pathway
elb00040  Pentose and glucuronate interconversions
elb00053  Ascorbate and aldarate metabolism
elb01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:elb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    VO54_00506 (aldH)
   00053 Ascorbate and aldarate metabolism
    VO54_00506 (aldH)
Enzymes [BR:elb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.26  2,5-dioxovalerate dehydrogenase
     VO54_00506 (aldH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AJW61995
UniProt: A0A0D5BJP1
Position
557873..559354
Genome map
AA seq 493 aa AA seqDB search
MIEETSFQVIDQKARQAANAYQFLKNTTIKERAAFMNAVADKIEALGENLLTTAHAETSL
PLARLTGEKARTIGQWRSYAKAVSTGIYTETRIDLPQASQLKADLRKYNIGLGPVAVFGA
SNFPFAFSTAGGDTASAIGAGCPVIVKAHPAHPETSQIMADAIAEVVKEFGWPEGIFSHI
TGKSNDIGAYLIQHNEIKAAAFTGSFAGGKALFDLGNQRKEPIPVFAEMGSINPVFAFQN
QLTVKTEQLAKEYAASLTLGVGQFCTNPGIFIAEAGDSFDRFKAALKNEILNVAPVNMLH
KGIFENFEKYKKLICSQPDVSTISEVNSDISEWEGRATVIETTAANFIKNNILSEEVFGP
FGIIVKCNSKDEMLQIAQQLQGQLTITIAATNEDVHLNIDIMNIVKDKCGRLLFNGMPTG
VEVVYGMQHGGPYPSTTDARFTSVGPDAVKRFVRPIAFQNWPDEFLPEELKNKNTLQISR
IVDGAIHSGSLKN
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgattgaagaaacatcttttcaggtaattgatcagaaagcccggcaggctgctaatgct
taccagtttctgaaaaatacaacaataaaagaacgtgcagcatttatgaatgctgttgcg
gacaaaattgaagcattaggtgagaatttacttactactgcacatgcagaaacatctttg
ccattagcccgattgaccggagaaaaggcaagaactataggtcaatggagaagttatgcc
aaagctgtgtcaaccggaatttatacagagaccagaatagaccttccacaagcttcccaa
ttaaaagcagatttgcgtaaatacaatatcggcttgggtcctgttgccgtttttggagcc
agcaattttccgtttgcattttctacagctggcggcgatactgccagtgctattggggca
ggctgtcctgttattgtaaaagcccatcctgcacatcctgaaacatcacagataatggca
gatgcaatagcagaggttgtaaaagaatttggatggccggaaggtatattcagtcatatt
accggaaagtctaatgatattggtgcatatttaatccaacataatgaaataaaagcagcg
gcatttacaggttcctttgcaggaggaaaggcattgtttgatttagggaatcagcgtaaa
gagcctatccccgtatttgcagagatgggaagtataaatcccgtttttgcctttcagaat
cagttaactgttaagacagaacaactagctaaggaatatgctgcatcattaactttaggt
gtcggacagttttgtactaaccccggaatattcattgctgaagctggtgatagtttcgac
cgtttcaaagccgcacttaagaatgaaattctgaatgtagcacctgtgaatatgttacat
aaaggaatttttgaaaattttgaaaaatataaaaaactgatttgctctcagcctgatgtt
tctactatttcagaagttaattcagatatttcggaatgggaaggacgtgctactgttata
gagacaacagcagctaattttattaaaaacaatattttaagtgaagaggttttcggtcca
tttggaatcattgtaaaatgcaattccaaagatgaaatgctccagattgcgcaacagtta
caagggcaattgactattactattgctgcaactaatgaagatgtgcacctgaatattgat
ataatgaatattgtaaaagacaagtgcggaagacttttattcaacggaatgccaacgggt
gtagaagttgtttacggaatgcagcatggcggtccttatccttcgactaccgatgcccgt
ttcacatctgtaggaccagatgccgttaaaagatttgttcgcccaatagcttttcagaat
tggccggatgaatttttaccggaagaactaaaaaacaagaatacactgcaaattagccgg
attgttgatggagcaatacattcaggatcattaaaaaattaa

DBGET integrated database retrieval system