KEGG   Elizabethkingia miricola: VO54_00618Help
Entry
VO54_00618        CDS       T03757                                 

Gene name
aldHT
Definition
(GenBank) Aldehyde dehydrogenase, thermostable
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
elb  Elizabethkingia miricola
Pathway
elb00010  Glycolysis / Gluconeogenesis
elb00053  Ascorbate and aldarate metabolism
elb00071  Fatty acid degradation
elb00280  Valine, leucine and isoleucine degradation
elb00310  Lysine degradation
elb00330  Arginine and proline metabolism
elb00340  Histidine metabolism
elb00380  Tryptophan metabolism
elb00410  beta-Alanine metabolism
elb00561  Glycerolipid metabolism
elb00620  Pyruvate metabolism
elb00625  Chloroalkane and chloroalkene degradation
elb01100  Metabolic pathways
elb01110  Biosynthesis of secondary metabolites
elb01120  Microbial metabolism in diverse environments
elb01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:elb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VO54_00618 (aldHT)
   00053 Ascorbate and aldarate metabolism
    VO54_00618 (aldHT)
   00620 Pyruvate metabolism
    VO54_00618 (aldHT)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VO54_00618 (aldHT)
   00561 Glycerolipid metabolism
    VO54_00618 (aldHT)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VO54_00618 (aldHT)
   00310 Lysine degradation
    VO54_00618 (aldHT)
   00330 Arginine and proline metabolism
    VO54_00618 (aldHT)
   00340 Histidine metabolism
    VO54_00618 (aldHT)
   00380 Tryptophan metabolism
    VO54_00618 (aldHT)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    VO54_00618 (aldHT)
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    VO54_00618 (aldHT)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VO54_00618 (aldHT)
Enzymes [BR:elb01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     VO54_00618 (aldHT)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: AJW62105
UniProt: A0A0D5BK01
Position
complement(660577..662127)
Genome map
AA seq 516 aa AA seqDB search
MAKTNQSFKIEKSLQHLGISKDNKGASSGTKFFATGKSIDSYSPVDGKLIASVKTASEKD
YEKIIKLAQQASSEFRLMPAPKRGEIIRQFGLKLREYKEDLGKLVSYEMGKSLQEGWGEV
QEMIDICDFAVGLSRQLHGFTMHSERSQHRMYEQYHPLGIVGIISAFNFPVAVWSWNAAL
ALICGNAIIWKPSEKTPLCAVACQNIMAEVLKENKLPEGISNLVISDHVIGQKMVESKDV
QLISFTGSTAVGREVSSKVAGRFGKSILELGGNNAIIITENADLEMSIIGAVFGAVGTAG
QRCTSTRRLIIHESVYDKVKTKLVKAYGQLKIGNPLDVNNHVGPLIDEKAVKQYENSIAK
CKKEGGKFIVEGGLLKGKEYASGCYVKPCIAEVKNSYEIVQHETFAPILYIMKYKTLEEA
IAMQNDVPQGLSSAIMTQNLREAELFLSHAGSDCGIANVNIGTSGAEIGGAFGGEKETGG
GRESGSDAWKYYMRRQTNTINYGKDLPLAQGIKFNI
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaccaatcaaagttttaaaatcgaaaaatctcttcagcatcttggaatctct
aaagacaataaaggtgcttcttccggaaccaaattttttgcaaccggaaaatctattgac
tcttattcaccggtagatggtaaactaatcgcaagcgtgaaaacagcttctgaaaaggat
tatgagaagattatcaaacttgcacagcaggcttcttctgagttcaggttaatgcctgca
cccaaaagaggagaaatcatcagacaattcggattaaagctgagagaatataaagaggat
cttggtaagctggtttcttatgaaatggggaaatctcttcaggaaggctggggagaggtg
caggaaatgattgatatctgtgatttcgcagtcggattatcccgtcagttacacggattc
accatgcattcggaacgttcgcaacacagaatgtacgaacaatatcatccacttggaatc
gtaggaattatatcagcttttaattttccggtagcggtatggagctggaatgcagcattg
gcccttatatgtggaaatgctattatatggaagccttcggaaaaaacaccactttgtgct
gtagcttgtcagaatattatggccgaagttctgaaagagaataagctgccggaaggaatt
tccaatcttgtaatcagcgatcatgtaataggacagaagatggtcgaaagtaaagatgtc
cagttgatatcatttacaggttctacggctgtaggaagggaagtttcttctaaagttgcc
ggacgcttcggtaaatctatcttagaattaggcggtaacaacgctattatcatcactgaa
aatgcggatctggaaatgtctattataggtgctgtatttggcgcagttggaacagcaggg
caaagatgtacctctacaagacgattgattatccacgagagtgtatatgataaagttaag
actaaactggtaaaagcttatggtcagcttaaaatcggaaatccattagatgtaaataac
catgtcggtccgttaattgacgaaaaggcagttaagcagtacgaaaactctattgcaaag
tgcaaaaaagaaggcggaaaattcattgttgaaggcggcttgctaaaaggaaaagaatat
gcttcgggctgttacgtaaaaccatgtatcgctgaagtgaaaaattcatacgaaattgta
cagcatgaaacctttgcacctattctttatattatgaaatataagacacttgaagaagct
attgctatgcaaaatgatgttccgcagggactttcttcagcaattatgacacaaaatctg
agagaagctgaattattcctgtcacatgcaggatccgactgtggaattgcgaatgtaaat
atcggaacttcgggtgcagagattggcggagcattcggtggagagaaagaaaccggcggc
ggaagagaatcaggatcggatgcatggaagtattatatgagacgacaaaccaatacgatt
aactatggtaaggatttaccattagctcagggaattaaatttaatatttaa

DBGET integrated database retrieval system