KEGG   Elizabethkingia miricola: VO54_00767Help
Entry
VO54_00767        CDS       T03757                                 

Gene name
apaG
Definition
(GenBank) Protein ApaG
  KO
K06195  ApaG protein
Organism
elb  Elizabethkingia miricola
Brite
KEGG Orthology (KO) [BR:elb00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    VO54_00767 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AJW62253
UniProt: A0A0D5BKP8
Position
complement(822942..823328)
Genome map
AA seq 128 aa AA seqDB search
MYSAITHSIQIIVEPFYDVKNSSPIQERYIFTYHITIKNNGSVPIKLLKRKWQIYDVGFG
VREVSGDGVIGMTPEIYPGEEFNYFSNVSLRSGVGAMQGNYLLMNLDSKDTFEVEIPKFS
LITEVVYN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtactcagcaattacccacagtattcagattattgttgaaccattttatgatgttaaa
aacagttcaccaatacaggaacgttatatcttcacgtaccatatcactattaaaaacaac
gggagcgtcccaataaaactcctaaaaaggaaatggcagatttatgatgttggttttggg
gtaagagaagtttccggagatggtgtaatcggtatgacaccggaaatctatccgggagaa
gaatttaactacttttccaatgtgtctcttcgttccggagtcggtgcgatgcaggggaac
tatttgttgatgaatctcgattcgaaagacacctttgaagtagaaatacccaagttttct
ctcattacagaagtcgtatataactaa

DBGET integrated database retrieval system