KEGG   Elizabethkingia miricola: VO54_01344Help
Entry
VO54_01344        CDS       T03757                                 

Gene name
mqo
Definition
(GenBank) Malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
elb  Elizabethkingia miricola
Pathway
elb00020  Citrate cycle (TCA cycle)
elb00620  Pyruvate metabolism
elb01100  Metabolic pathways
elb01110  Biosynthesis of secondary metabolites
elb01120  Microbial metabolism in diverse environments
elb01130  Biosynthesis of antibiotics
elb01200  Carbon metabolism
Module
elb_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elb_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:elb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    VO54_01344 (mqo)
   00620 Pyruvate metabolism
    VO54_01344 (mqo)
Enzymes [BR:elb01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     VO54_01344 (mqo)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase DUF4108 FAD_binding_3 L-fibroin SMC_ScpA
Motif
Other DBs
NCBI-ProteinID: AJW62826
UniProt: A0A0D5BLZ4
Position
complement(1450392..1451873)
Genome map
AA seq 493 aa AA seqDB search
MNPKPKYDVVLIGGGIMSATLGTMLHEFDPNLKIALFERLKDVARESSSAWNNAGTGHSA
FCELNYTTEKKDGSVDISKAEKIAEQFEISKQFWAYLISKGYIDSPREFINSCPHMSLVF
GEKDIEFLKKRHETMIKSHLFEGMEFSEDHGKLKEWVPLVMRSRNASEKLAATRATMGTD
VDFGALTKKLVKHLEESSNVEVFRYHEIKDIDDNNGKWRMKIKDRLNNHPVEVEADFVFI
GAGGYALPLLDSSGIEESKGYGGFPVSGQWLVTKDPELIAMHHAKVYTQATVDAPPMSVP
HLDLRIIDGEKALLFGPFAGFSTKFLKNGSYLDLPESVNFKNIRSLFGAWWHNLSLTRYL
IRQVTMNKDQRIAHLRDFIKDANADKWELMIAGQRVQIIKKDDAEGGKLEFGTEVVTNKQ
GTIASLLGASPGASTAAFAMINILEKCFGDKLQKEWRDKLLEMVPTYGRKLKDSAELTNR
VRNYTKEKLELDY
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgaaacctaaatacgatgtcgttcttattggcggaggtataatgagtgctact
ttgggtactatgttacatgagtttgacccaaacctgaaaattgcacttttcgaaagatta
aaagatgtagctcgcgagagctcatctgcgtggaataatgcaggaacaggtcactctgct
ttttgtgaactgaactatactactgagaagaaagacggctcggtagacatcagtaaagct
gaaaaaattgcagaacaatttgaaatttcaaaacaattctgggcttatctgattagcaaa
ggatatattgattctcccagagagtttatcaattcctgcccgcatatgagtctggtattt
ggagaaaaagatattgagtttcttaaaaaacgtcatgagacaatgataaaatcccatttg
tttgaaggaatggaattttctgaagatcatggtaaactaaaagaatgggttcctttggtt
atgcgttcacgtaatgcttctgaaaaattagcagctacaagagcaacaatgggaacagat
gtagactttggggctttaaccaaaaagttggtaaaacaccttgaagaaagctctaacgtt
gaagtattccgttatcacgagatcaaggatatagatgataacaatggtaaatggagaatg
aaaataaaagacaggttaaacaaccatcctgtagaagtagaggcagattttgttttcatt
ggagcaggggggtatgcattgcctcttttagacagttcaggtattgaagaaagtaaaggt
tacggaggtttccctgttagtggacaatggttggtaaccaaagatcctgagcttattgca
atgcaccatgcaaaagtatatacacaggctactgtagatgcgccaccaatgagtgtgcct
cacttagaccttagaattatcgatggagaaaaggctttgcttttcggtccatttgcagga
ttctctactaaattccttaaaaacggaagttacctggatttaccggaaagtgtaaacttt
aaaaatatccgttctttattcggtgcatggtggcataatctgtcactgacgagatacctg
atcagacaggtaacgatgaataaagatcagcgaattgcgcaccttagagatttcattaaa
gatgctaatgccgacaaatgggaattaatgattgccgggcaaagagtacagattattaag
aaagatgatgctgaaggtggtaaactggaattcggaaccgaggttgtaacgaacaaacaa
ggaactattgcatctctgttaggcgcttctccgggggcgagtacagcagcttttgccatg
attaatattcttgaaaaatgtttcggagacaaacttcagaaagaatggagagataagctt
ctggaaatggttcctacctacggaagaaagttaaaagacagtgctgagcttacaaacaga
gtgagaaattatactaaagaaaaactggaattagattactaa

DBGET integrated database retrieval system