KEGG   Escherichia coli clone D i14: i14_0174Help
Entry
i14_0174          CDS       T02003                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde aminotransferase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00860  Porphyrin and chlorophyll metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
Module
elc_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
elc_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:elc00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    i14_0174 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:elc01007]
    i14_0174 (hemL)
Enzymes [BR:elc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     i14_0174 (hemL)
Amino acid related enzymes [BR:elc01007]
 Aminotransferase (transaminase)
  Class III
   i14_0174 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Aminotran_1_2
Motif
Other DBs
NCBI-ProteinID: AER87691
Position
complement(180509..181789)
Genome map
AA seq 426 aa AA seqDB search
MSKSENLYSAARELIPGGVNSPVRAFTGVGGTPLFIEKADGAYLYDVDGKAYIDYVGSWG
PMVLGHNHPAIRNAVIEAAERGLSFGAPTEMEVKMAQLVTELVPTMDMVRMVNSGTEATM
SAIRLARGFTGRDKIIKFEGCYHGHADCLLVKAGSGALTLGQPNSPGVPADFAKHTLTCT
YNDLASVRAAFEQYPQEIACIIVEPVAGNMNCVPPLPEFLPGLRALCDEFGALLIIDEVM
TGFRVALAGAQDYYGVEPDLTCLGKIIGGGMPVGAFGGRRDVMDALAPTGPVYQAGTLSG
NPIAMAAGFACLNEVAQPGVHETLDELTTRLAEGLREAAEEAGIPLVVNHVGGMFGIFFT
DAESVTCYQDVMACDVERFKRFFHMMLDEGVYLAPSAFEAGFMSVAHSMEDINNTIDAAR
RVFAKL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgagtaagtctgaaaatctttacagcgcagcgcgcgagctgatccctggcggtgtgaac
tcccctgttcgcgcctttactggcgtgggcggcactccactgtttatcgaaaaagcggac
ggcgcttatctgtacgatgttgatggcaaagcctatatcgattatgtcggttcctggggg
ccgatggtgctgggccataaccatccggcgatccgcaatgccgtgattgaagccgccgag
cgtggtttaagctttggtgcaccaaccgaaatggaagtgaaaatggcgcaactggtgacc
gaactggtcccgaccatggatatggtgcgcatggtgaactccggcactgaagcgacgatg
agcgccatccgcctggcccgtggttttaccggtcgcgacaaaattattaaatttgaaggt
tgttaccacggtcacgctgactgcctgctggtgaaagccggttctggcgcactcacgtta
ggccagccaaattcgccgggcgttccggcagatttcgccaaacataccttaacctgtact
tataacgatctggcctctgtacgcgccgcgtttgagcaatacccgcaagagattgcctgt
attatcgtcgagccggtggcaggcaatatgaactgcgttccaccgctgccagagttcctg
ccaggtctgcgcgcgctgtgcgacgaatttggcgcgttgctgatcatcgatgaagtgatg
accggtttccgcgtagcgctagctggcgcacaggattattacggtgtggaaccggatctc
acctgcctcggcaaaatcatcggcggtggaatgccggtaggcgcattcggtggtcgtcgt
gatgtaatggatgcgctggccccgaccggtccggtctatcaggcgggtacgctttccggt
aacccgattgcgatggctgctggtttcgcctgtctgaatgaagtcgcacagccgggcgtt
cacgagacgctggatgagctgacaacacgtctggcagaaggtctgcgggaagcggcagaa
gaagccggaattccgctggtggtaaaccacgttggcggcatgttcggtattttctttacc
gacgccgagtccgtgacgtgctatcaggatgtgatggcctgtgacgtggaacgctttaag
cgtttcttccatatgatgctggacgaaggtgtttacctggcaccgtcagcgtttgaagcg
ggctttatgtccgtggcgcatagcatggaagatatcaataacaccatcgatgctgcacgt
cgggtgtttgcgaagttgtga

DBGET integrated database retrieval system