KEGG   Escherichia coli clone D i14: i14_0919Help
Entry
i14_0919          CDS       T02003                                 

Gene name
ybjU
Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00260  Glycine, serine and threonine metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
elc01130  Biosynthesis of antibiotics
elc01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:elc00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    i14_0919 (ybjU)
Enzymes [BR:elc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     i14_0919 (ybjU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP DegT_DnrJ_EryC1 CheD
Motif
Other DBs
NCBI-ProteinID: AER88424
Structure
PDB: 

Position
complement(929056..930057)
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPSRAMLEAMMAAPVGDDVYGDDPTVNALQDYAAELSGKEAAIFLPTGTQ
ANLVALLSHCERGEEYIVGQAAHNYLFEAGGAAVLGSIQPQPIDAAADGTLPLDKVAMKI
KPDDIHFARTKLLSLENTHNGKVLPREYLKEVWEFTRKRNLALHVDGARIFNAVVAYGCE
LKEITQYCDSFTICLSKGLGTPVGSLLVGNRDYIKRAIRWRKMTGGGMRQSGILAAAGLY
ALKNNVARLQEDHDNAAWMAKQLREAGADVMRQDTNMLFVRVGEENAAALGEYMKARNVL
INASPIVRLVTHLDVSRAQLAEVAAHWRAFLAR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgattgatttacgcagtgataccgttacccgaccgagccgcgccatgctcgaagcgatg
atggccgccccggttggggacgacgtttacggagacgaccctaccgttaatgctctgcag
gactatgcagccgagctttccggtaaagaagccgccatttttctgcctaccggcactcag
gccaacctggtcgctctgctcagtcactgcgaacgcggcgaagagtatatcgtcggtcag
gccgcgcataactatctgtttgaagccggtggcgcagcagtgctgggcagtattcagccg
caacccatcgacgcagctgccgacggcacgctaccgctggataaagtggcgatgaaaatc
aaacccgacgatatccatttcgcccgcaccaaattactcagtctggaaaacacccacaac
ggcaaagtgctgccgcgtgaatacttaaaagaggtatgggaatttacccgcaagcgcaat
ctggcgctgcatgttgacggtgcgcgcatctttaatgccgtggtggcttacggctgcgaa
ctgaaagagatcacacaatattgtgactcgttcaccatttgcctgtcgaaaggtcttggg
acgccagtcggttcattactcgtcggtaatcgtgattacattaaacgtgccattcgctgg
cggaaaatgacaggtggcgggatgcgccagtccggcattctggctgccgccgggctgtat
gcgctgaaaaataacgtcgcacgtttgcaggaagaccacgacaacgccgcctggatggcg
aagcaactgcgtgaagcaggcgcggatgtgatgcgtcaggacaccaatatgctgtttgtt
cgcgtcggggaagaaaatgctgccgcgttaggcgaatacatgaaagcgagaaacgtactg
attaacgcctcgccgattgtccgcctggtgacgcatcttgacgtctcgcgcgctcagctg
gcggaagtcgccgcccactggcgcgcattcctggcgcgttaa

DBGET integrated database retrieval system