KEGG   Escherichia coli clone D i14: i14_1558Help
Entry
i14_1558          CDS       T02003                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase subunit beta
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00260  Glycine, serine and threonine metabolism
elc00400  Phenylalanine, tyrosine and tryptophan biosynthesis
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01130  Biosynthesis of antibiotics
elc01230  Biosynthesis of amino acids
Module
elc_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    i14_1558 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    i14_1558 (trpB)
Enzymes [BR:elc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     i14_1558 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AER89053
Structure
PDB: 

Position
complement(1505103..1506296)
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFNDLLKNYAGRPTALT
KCQNITAGTNTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILEREGRLPDAVIACVGGGSNAIGM
FADFINETDVGLIGVEPGGHGIETGEHGAPLKHGRVGIYFGMKAPMMQTEDGQIEESYSI
SAGLDFPSVGPQHAYLNSTGRADYVSITDDEALEAFKTLCLHEGIIPALESSHALAHALK
MMRENPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacattacttaacccctattttggtgagtttggcggcatgtacgtgccacaaatc
ctgatgcctgctctgcgccagctggaagaagcttttgtcagcgcgcaaaaagatcctgaa
tttcaggctcagttcaacgacctgctgaaaaactatgccgggcgtccaaccgcgctgacc
aaatgccagaacattacagccgggacgaacaccacgctgtatctgaagcgcgaagatttg
ctgcacggcggcgcgcataaaactaaccaggtgctcggtcaggctttactggcgaagcgg
atgggtaaaactgaaattattgccgaaaccggtgccggtcagcatggcgtggcgtcggcc
cttgccagcgccctgctcggcctgaaatgccgaatttatatgggtgccaaagacgttgaa
cgccagtcgcccaacgttttccggatgcgcttaatgggtgcggaagtgatcccggtacat
agcggttccgcgaccctgaaagatgcctgtaatgaggcgctacgcgactggtccggcagt
tatgaaaccgcgcactatatgctgggtaccgcagctggcccgcatccttacccgaccatt
gtgcgtgagtttcagcggatgattggcgaagaaacgaaagcgcagattctggaaagagaa
ggtcgcctgccggatgccgttatcgcctgtgttggcggtggttcgaatgccatcggtatg
tttgcagatttcatcaacgaaaccgacgtcggcctgattggtgtggagcctggcggccac
ggtatcgaaactggcgagcacggcgcaccgttaaaacatggtcgcgtgggcatctatttc
ggtatgaaagcgccgatgatgcaaaccgaagacgggcaaattgaagagtcttactccatt
tctgccgggctggatttcccgtccgtcggcccgcaacatgcgtatctcaacagcactgga
cgcgctgattacgtgtctattaccgacgatgaagccctggaagcctttaaaacgctttgc
ctgcatgaagggatcatcccggcgctggaatcctcccacgccctggcccatgcgctgaaa
atgatgcgcgaaaatccggaaaaagagcagctactggtggttaacctttccggtcgcggc
gataaagacatcttcaccgttcacgatattttgaaagcacgaggggaaatctga

DBGET integrated database retrieval system