KEGG   Escherichia coli clone D i14: i14_1763Help
Entry
i14_1763          CDS       T02003                                 

Gene name
tam
Definition
(GenBank) trans-aconitate 2-methyltransferase
  KO
K00598  trans-aconitate 2-methyltransferase [EC:2.1.1.144]
Organism
elc  Escherichia coli clone D i14
Brite
KEGG Orthology (KO) [BR:elc00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    i14_1763 (tam)
Enzymes [BR:elc01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.144  trans-aconitate 2-methyltransferase
     i14_1763 (tam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_23 Methyltransf_11 Methyltransf_31 Methyltransf_12 MTS FtsJ NodS Methyltransf_2 Methyltransf_32 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: AER89252
Position
1726186..1726944
Genome map
AA seq 252 aa AA seqDB search
MSDWNPSLYLHFAAERSRPAVELLARVPLENIEYIADLGCGPGNSTALLHQRWPAARITG
IDSSPAMIAEARSALPDCLFVEADIRNWQPEQALDLIFANASLQWLPDHYELFPHLVSLL
SPLGVLAVQMPDNWLEPTHVLMREVAWEQNYPDRGREPLAGVHAYYDILSEAGCEVDIWR
TTYYHQMPSHQAIIDWVTATGLRPWLQDLTESEQQHFLTRYHQMLEEQYPLQENGQILLA
FPRLFIVARRTE
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtctgactggaacccctctttatatctgcactttgccgctgaacgatcgcgtccggcg
gtggagctgcttgccagggtgccgctggagaatatcgaatacattgccgatcttggctgt
ggcccaggtaacagcaccgcccttctacaccaacgttggcctgctgccaggataacgggc
atcgactcatctccggcgatgattgctgaagcgcgcagtgctttgccagactgcctgttt
gtggaagcagatatccgcaactggcaaccggaacaggcactcgatctgatttttgctaat
gcctcgctgcaatggctgcccgaccactacgaattgtttcctcatttggtttcgttactc
agtccgctgggcgtgctggcagtacagatgccagataactggctggagccgacccatgtg
ctcatgcgcgaagttgcctgggaacaaaactacccggatcgcgggcgtgagccgctggct
ggcgttcatgcttactacgatattctgagtgaagccggatgtgaggtcgatatctggcga
accacttactatcaccagatgccgtcgcaccaggcgattatcgattgggtgaccgccact
ggattacgtccgtggttacaggatctgaccgagagcgaacagcagcattttcttacgcgc
taccatcagatgctggaagagcaatatcccctccaggagaacggacagatattgctggca
tttccgcgtctgtttattgttgcccgccgtacggagtaa

DBGET integrated database retrieval system