KEGG   Escherichia coli clone D i14: i14_2366Help
Entry
i14_2366          CDS       T02003                                 

Gene name
galF
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00040  Pentose and glucuronate interconversions
elc00052  Galactose metabolism
elc00500  Starch and sucrose metabolism
elc00520  Amino sugar and nucleotide sugar metabolism
elc01100  Metabolic pathways
elc01130  Biosynthesis of antibiotics
Module
elc_M00362  Nucleotide sugar biosynthesis, prokaryotes
elc_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:elc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    i14_2366 (galF)
   00052 Galactose metabolism
    i14_2366 (galF)
   00500 Starch and sucrose metabolism
    i14_2366 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    i14_2366 (galF)
Enzymes [BR:elc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     i14_2366 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 EFP_N
Motif
Other DBs
NCBI-ProteinID: AER89845
Position
complement(2339246..2340151)
Genome map
AA seq 301 aa AA seqDB search
MDEIMTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEILLVT
HASKNAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQGEPLGLGHSILC
ARPAIGDNPFVVVLPDVVIDDASADPLRYNLAAMIARFNETGRSQVLAKRMPGDLSEYSV
IQTKEPLDREGKVSRIVEFIEKPDQPQTLDSDIMAVGRYVLSADIWPELERTQPGAWGRI
QLTDAIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKGIEKLLS
E
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
gtggatgaaataatgacgaatttaaaagcagttattcctgtagcgggtcttgggatgcat
atgttgcctgccactaaggcgattcccaaagagatgctaccgatcgtcgacaagccaatg
attcagtacatcgttgacgagattgtggctgcagggatcaaagaaatcctcctggtaact
cacgcttccaagaacgcggtcgaaaaccacttcgacacctcttatgaattagaatctctc
cttgaacagcgcgtgaagcgccaactgctggcggaagtacagtccatttgcccgccgggc
gtgacaattatgaacgtgcgtcagggcgaacctttaggtttgggccattccattttgtgt
gcgcgacctgccattggtgacaacccatttgtcgtggtactgccagacgttgtgatcgac
gatgccagcgccgacccgctacgttacaaccttgctgccatgattgcgcgcttcaacgaa
acgggccgcagccaggtgctggcaaaacgtatgccgggtgacctctctgaatactccgtc
attcagaccaaagaaccgctggatcgcgaaggtaaagtcagccgcattgttgaatttatc
gaaaaaccggatcagccgcagacgctggactcagacatcatggccgttggtcgctatgtg
ctttctgcagatatttggccggaacttgaacgcactcagcctggtgcatgggggcgtatt
cagctgactgatgccatcgctgaactggcgaaaaaacagtccgttgatgccatgctgatg
acaggtgacagctacgactgcggtaaaaaaatggggtatatgcaggcatttgtgaagtat
ggactacgcaacctgaaagaaggggcgaagttccgtaaagggattgagaagctgttaagc
gaataa

DBGET integrated database retrieval system