KEGG   Escherichia coli clone D i14: i14_2551Help
Entry
i14_2551          CDS       T02003                                 

Gene name
yojH
Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
elc  Escherichia coli clone D i14
Pathway
elc00020  Citrate cycle (TCA cycle)
elc00620  Pyruvate metabolism
elc01100  Metabolic pathways
elc01110  Biosynthesis of secondary metabolites
elc01120  Microbial metabolism in diverse environments
elc01130  Biosynthesis of antibiotics
elc01200  Carbon metabolism
Module
elc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
elc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:elc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    i14_2551 (yojH)
   00620 Pyruvate metabolism
    i14_2551 (yojH)
Enzymes [BR:elc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     i14_2551 (yojH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3 K_oxygenase FAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AER90022
Position
complement(2529381..2531027)
Genome map
AA seq 548 aa AA seqDB search
MKKVTAMLFSMAVGLNAVSMAAKAKASEEQETDVLLIGGGIMSATLGTYLRELEPEWSMT
MVERLEGVAQESSNGWNNAGTGHSALMELNYTPQNADGSISIEKAVAINEAFQISRQFWA
HQVERGVLRTPRSFINTVPHMSFVWGEDNVNFLRARYAALQQSSLFRGMRYSEDHAQIKE
WAPLVMEGRDPQQKVAATRTEIGTDVNYGEITRQLIASLQKKSNFSLQLSSEVRALKRND
DNTWTVTVADLKNGTAQNIRAKFVFIGAGGAALKLLQESGIPEAKDYAGFPVGGQFLVSE
NPDVVNHHLAKVYGKASVGAPPMSVPHIDTRVLDGKRVVLFGPFATFSTKFLKNGSLWDL
MSSTTTSNVMPMMHVGLDNFDLVKYLVSQVMLSEEDRFEALKEYYPQAKKEDWRLWQAGQ
RVQIIKRDADKGGVLRLGTEVVSDQQGTIAALLGASPGASTAAPIMLNLLEKVFGDRVSS
PQWQATLKAIVPSYGRKLNGDVAATERELQYTSEVLGLKYDKPQAVDSTPKPQLKPQLVQ
KEVADIAL
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtgactgccatgctcttctcgatggccgtggggcttaatgccgtttcgatg
gcggcaaaagcgaaagcgtccgaggagcaggaaactgatgtactgttgattggcggcggc
attatgagcgccacgttggggacctatttacgcgagctggagcctgaatggtcgatgacc
atggtggagcgcctggaaggtgtcgcgcaggagagttcgaacggctggaacaacgccgga
accgggcattctgcactgatggaactgaactacaccccgcaaaacgccgatggcagcatc
agtattgaaaaagcagtcgccattaacgaagcatttcagatttcgcgccagttctgggcg
caccaggtcgagcgcggcgtgctgcgtacaccgcgttcatttatcaataccgttccgcat
atgagctttgtctggggcgaggataacgttaatttcctgcgagcccgttacgccgcgttg
caacaaagctcgctgtttcgcggtatgcgttactctgaagatcacgcgcagatcaaagag
tgggcaccgttagtgatggaagggcgcgatccgcaacagaaagtggcagccacgcgtacg
gaaattggcactgatgtgaactatggcgagatcacccgccagttaattgcttccttgcag
aagaaatctaatttttcgctgcaactcagcagcgaagtccgcgccctaaagcgtaatgac
gataacacctggaccgttaccgttgccgatctgaaaaatggcactgcacagaacatccgc
gccaaatttgtctttatcggcgcgggcggtgcggcgctgaagctgttacaggaatcgggg
attccggaagcgaaagactacgccggtttcccggtgggcggacagttccttgtttcggaa
aatccggacgtggttaatcaccatctggcgaaggtttacggtaaagcatccgttggcgca
ccaccgatgtcggttccgcatatcgatacccgtgtgctggacggtaaacgcgtcgtgttg
tttgggccatttgccaccttctcaactaaattcctcaaaaacggttcattgtgggatctg
atgagttccaccaccacctctaacgtgatgccgatgatgcacgtcgggctggataatttc
gatctggtgaaatatctggtgagtcaggtgatgttgagtgaagaggatcgttttgaagcg
ttgaaagagtactatccgcaggcgaaaaaagaggactggcgtttgtggcaagcggggcag
cgcgtgcagattatcaagcgtgatgccgataaaggtggcgtactgcgtctgggtactgaa
gtcgtcagtgaccagcaagggaccattgccgcgctcctgggggcatcgccaggggcgtca
accgccgcgccgattatgttgaatctgctggaaaaagtatttggcgatcgcgtttccagc
ccgcaatggcaggctacgttgaaagcgatcgttccgtcttatggacgcaagctgaacggt
gatgtagcggcaacagaacgcgagttgcagtacaccagcgaagtgctggggctgaaatac
gacaagccgcaggcagtagatagtacgccgaaaccgcagttgaaaccgcaactcgttcaa
aaagaagtggcggatattgcgttgtaa

DBGET integrated database retrieval system