KEGG   Escherichia coli clone D i14: i14_3082Help
Entry
i14_3082          CDS       T02003                                 

Gene name
yqcB
Definition
(GenBank) tRNA pseudouridine synthase C
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
elc  Escherichia coli clone D i14
Brite
KEGG Orthology (KO) [BR:elc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:elc03016]
    i14_3082 (yqcB)
Enzymes [BR:elc01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     i14_3082 (yqcB)
Transfer RNA biogenesis [BR:elc03016]
 Prokaryotic type
  tRNA modification factors
   Psudouridine synthases
    i14_3082 (yqcB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AER90544
Position
complement(3086354..3087136)
Genome map
AA seq 260 aa AA seqDB search
MLEILYQDEWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIQKRYHAIVRGWLMEEAVLDYPLVEELDKIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTTRYGLVELEPKTGRKHQLRRHLAHLRHPIIGDSK
HGDLRQNRSGAEHFGLQRLMLHASQLSLTHPFTGEPLAIHAGLDDTWMQALSQFGWRGLL
PENERVEFSAPSGQDGEISS
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgctggaaatactctatcaggatgaatggctggttgcggtaaataaaccctccggctgg
ctggttcaccgcagctggctggatcgcgacgagaaagtagtggtcatgcaaaccgtgcgt
gaccagataggccagcatgtttttactgctcatcgtctggaccgaccaacttctggtgtg
ttgttgatgggattatccagcgaagccggacggctgctggcacaacagtttgaacagcac
caaatccagaaacgttaccatgcgattgtgcgtggctggttgatggaagaagcggtgctg
gattatccactggtggaagaactggacaaaatcgctgataaatttgcccgcgaagataaa
ggcccgcagccagcagtgacgcattatcgcggtctggcgaccgtagaaatgccggtagcg
accggacgttacccgaccacgcgctacggcctggtggaactggagccgaaaactggacgc
aagcaccagcttcgtcgccatcttgcccatttgcggcacccgattattggcgacagcaaa
catggtgatttacgccagaatcgcagcggcgctgagcattttggccttcagcggttaatg
ctgcatgccagtcagttgtcattgacgcatccttttactggcgagccgctggctattcac
gcgggcctggacgacacctggatgcaggcattatcacaatttggctggcgcggtctgctt
cctgaaaatgaaagggttgagttcagtgcgccatcgggtcaggatggagagataagttcc
taa

DBGET integrated database retrieval system