KEGG   Escherichia coli clone D i14: i14_3107
Entry
i14_3107          CDS       T02003                                 

Definition
(GenBank) hypothetical protein
  KO
K11901  type VI secretion system protein ImpB
Organism
elc  Escherichia coli clone D i14
Brite
KEGG Orthology (KO) [BR:elc00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:elc02044]
    i14_3107
Secretion system [BR:elc02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   i14_3107
SSDB
Motif
Pfam: T6SS_VipA GerD Imm65
Other DBs
NCBI-ProteinID: AER90569
Position
3111538..3112059
AA seq 173 aa
MDDEEKDMADSFQNEVPAARVNIKLDLHTGNAKKKVELPLKLLAVGDYSNGKEQRPLSER
DKVDINKNNFNSVMAEFSPAVNLTVEDTLNGNGNEQNIALEFKSLKDFEPEQVAKNIPQL
RVLLAMRNLLRDLKSNLLDNATFRRELENILKDPTLSSELRDELAKIAPQENV
NT seq 522 nt   +upstreamnt  +downstreamnt
gtggatgatgaggaaaaggatatggccgacagtttccagaatgaagttcccgccgctcgt
gtaaatatcaagcttgatctgcatacaggcaatgctaaaaagaaagttgaactccccctc
aagcttcttgccgtaggcgattacagtaacggaaaagagcaacgtccgctgtccgaacgg
gacaaggttgatatcaataaaaacaacttcaacagcgtcatggctgagttttcgcctgcg
gttaatttaacagtagaagatacgctaaacggaaacggtaatgaacaaaatatcgcgctt
gaatttaaaagcctgaaggattttgaacccgaacaggtagcaaaaaatattccgcaactt
cgtgtattactcgctatgcgcaatttactacgtgacctgaaatccaatctgctggataac
gcaacgtttcgccgtgaactggaaaatatcctgaaagacccgacgctcagttcagaactg
cgtgatgaactggcgaaaattgcgccgcaggagaacgtttaa

DBGET integrated database retrieval system